SecReT4
Protein ID: 87198337
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0312
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]337044..338354 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ2GBL3
KEGG IDnar:Saro_0312
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.2e-54, Aligned region: 37..261
Protein Sequence: 436 a.a.     [Download]
>gi|87198337|ref|YP_495594.1| conjugal transfer protein TrbL [Novosphingobium aromaticivorans DSM 12444]
MGGTGVVDRFLDIFSRYIDSGFGLLSGEVAFIATTLIVIDVTLAALFWTWGEQDDVIARLVKKTLFVGIF
AYIIGNWNNLARIVFESFAGLGLKASGTGFSAGELLQPGRVAQVGLDAARPLIEAISDLMGFVSFFENFL
QIVILLVAWALVVIAFFILSIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIVGIGSTIFSEFTSAIPAEPTIEDALSIVLASLTLLGLGIFGPGIANGIVAGGPQLGAGAAAGTALMA
GGAAAGAVAGAKLAGGAVASAASSVAHGTSRAAGGATTAYAMGSAGKSGAAAIGSGAAAVGDAALGATVS
PLRKAGEGLQQSFREGGRSAITNTGGTITPGPDTPAPPTAEAGQPAWARTMKNRQTLAQGATIAAHTLKA
GDSSGAGASIDTSEKD
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c338354-337044 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGGGTGGCACCGGCGTCGTCGACCGCTTCCTCGACATCTTCTCACGCTACATCGATTCCGGGTTCGGCC
TGCTGTCGGGCGAGGTCGCTTTCATCGCGACCACGCTGATCGTCATCGATGTGACGCTTGCCGCCCTGTT
TTGGACCTGGGGCGAACAGGACGACGTCATCGCCCGCCTGGTCAAGAAGACCCTGTTTGTGGGGATCTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCCCGGATTGTCTTCGAGAGCTTTGCCGGGCTCGGCCTCA
AGGCCAGCGGCACCGGCTTTTCGGCAGGCGAGTTGCTCCAGCCCGGCCGTGTCGCCCAGGTCGGGCTCGA
TGCCGCACGGCCCCTGATCGAGGCGATCTCGGACCTCATGGGCTTCGTCAGCTTCTTCGAGAACTTCCTG
CAGATCGTCATCTTGCTCGTCGCCTGGGCGCTGGTCGTGATCGCCTTCTTCATTCTCTCGATCCAGCTGT
TCGTCACCCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTCCTCATTCCCTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTCGGCAACGTGGTCTCGAGCGGGATCAAGGTGCTCGTGCTG
GCGGTCATCGTCGGCATCGGCTCGACCATCTTTTCGGAATTCACCAGCGCCATTCCGGCCGAGCCAACCA
TCGAGGATGCACTCTCGATCGTGCTGGCGAGCCTGACCCTGCTCGGGCTCGGCATTTTCGGACCCGGCAT
TGCCAACGGCATTGTCGCCGGAGGCCCGCAGCTGGGGGCTGGTGCCGCCGCAGGAACCGCACTCATGGCG
GGTGGGGCCGCTGCTGGCGCGGTTGCCGGAGCAAAGCTTGCCGGCGGCGCAGTAGCCAGCGCCGCCTCCA
GCGTTGCCCACGGCACCTCTCGTGCCGCCGGCGGCGCCACGACTGCCTATGCTATGGGTTCTGCCGGGAA
GAGCGGCGCTGCCGCTATCGGTTCTGGCGCGGCGGCTGTCGGAGACGCGGCGCTGGGCGCCACCGTCTCG
CCGCTGCGCAAGGCCGGCGAAGGCCTCCAGCAATCGTTCCGTGAGGGCGGGCGGTCCGCGATCACCAACA
CCGGCGGCACCATCACGCCGGGTCCCGACACCCCGGCTCCGCCCACTGCCGAGGCCGGTCAGCCGGCCTG
GGCCCGGACGATGAAGAACCGGCAGACCCTCGCGCAAGGCGCCACCATCGCCGCCCACACGCTCAAGGCT
GGCGACAGCAGCGGTGCGGGCGCTTCCATCGACACATCGGAAAAGGACTGA
 Primer design