SecReT4
Protein ID: 87198339
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0314
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]338682..339458 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ2GBL1
KEGG IDnar:Saro_0314
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 258 a.a.     [Download]
>gi|87198339|ref|YP_495596.1| conjugal transfer protein TrbJ [Novosphingobium aromaticivorans DSM 12444]
MKSPLKPPGLRPILAAGAAVLSLGAAVIAPAPAHAQFGFGGIVYDPTNYAQNVLTAARTLEQINNQIRSL
QNQATSLINEARNLQSLPLTVLEPIQQQIRQTQQLLSKAQGIAYDVQAIEREFARNYSPASLTGSQRDMV
RGAEDRWRTSVGAFEDALKVQAGAVQNIEGSRTAVQSLVTASQSATGALQAAQAGNQLLALQSQQLADLI
ATMAAMNRAQALDAANEAAAKAQAREQLRRFMAPGRGYVPVSTKLYRD
 
Nucleotide Sequence: 777 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c339458-338682 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGAAATCGCCGCTCAAACCCCCGGGCCTCCGGCCGATCCTCGCGGCAGGCGCAGCTGTGCTGTCGCTGG
GTGCAGCCGTGATCGCGCCCGCCCCGGCCCATGCCCAGTTCGGGTTCGGCGGGATCGTCTACGATCCCAC
CAACTACGCCCAGAACGTGCTGACGGCGGCCCGCACGCTCGAGCAGATCAACAATCAGATCCGTTCATTG
CAAAACCAGGCGACGTCGCTGATCAACGAGGCGCGCAATCTGCAAAGTCTGCCGCTAACCGTGCTCGAGC
CGATCCAGCAGCAGATCCGGCAGACCCAGCAACTGCTGAGCAAGGCCCAGGGAATTGCCTATGACGTGCA
GGCGATCGAGCGCGAGTTCGCCCGCAACTATTCGCCGGCCAGCCTGACCGGTTCGCAGCGCGACATGGTT
CGCGGCGCGGAGGACCGCTGGCGCACCAGCGTCGGGGCCTTCGAAGATGCGCTCAAGGTCCAGGCCGGAG
CCGTCCAGAACATCGAAGGCTCCCGCACCGCCGTGCAGAGCCTGGTCACCGCCAGCCAGTCGGCCACCGG
CGCGCTTCAGGCGGCGCAAGCCGGAAACCAGCTGCTCGCGCTGCAATCGCAGCAGCTGGCCGATCTCATC
GCGACCATGGCGGCCATGAACCGGGCCCAGGCGCTCGATGCTGCCAATGAAGCTGCCGCCAAGGCCCAGG
CCCGCGAGCAGCTGCGCCGCTTCATGGCGCCGGGCCGCGGCTACGTGCCGGTGAGCACGAAGCTCTATCG
GGACTGA
 Primer design