SecReT4
Protein ID: 87198340
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0315
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]339464..341929 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ2GBL0
KEGG IDnar:Saro_0315
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-36, Aligned region: 442..715
CagE_TrbE_VirB [PF03135], Evalue: 1.2e-15, Aligned region: 181..388
Protein Sequence: 821 a.a.     [Download]
>gi|87198340|ref|YP_495597.1| conjugal transfer ATPase TrbE [Novosphingobium aromaticivorans DSM 12444]
MFSLREYRNKADRLADFLPWAALVAPGVVLNKDGSFQRSARFRGPDLDSATPAELIATTARLNSALRRLG
SGWAIFVEAVRRPAHDYPESDFPDAASALVERERAAQFAEEGAHFESAYYLTLVWMPPAEDAARAESWLY
EGKAHQGVQARELLELFSDRTDRLLRLIEGFVPEAAWLDDSETLTYLHSCISTRNHRVRVPETPMHLDAL
LADEPLTGGLEPRLGRAHLRTLTVVGFPSATFPGILDELNSQGFAYRWSTRAIMLDKTDAAKLLGKIRRQ
WFAKRKSVAAILKEVMTNEASALLDSDASNKAADADAALQELGSDLQGMAYVTATVTVWDEDAAMAAEKL
RLVEKVIQGRDFTVIVEGMNALEAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPEWDAHFRAPP
LFYARTEGSTPFRFALHVGDVGHTLIVGPTGAGKSVLLALMALQFRRYDRAQIFAFDFGGSIRAAALACG
GDWQDLGTSLAGDGAGAVMLQPLARIDEPAERNWAAEWLQAVLTGEGVTVDPATKEHLWSALTSLSTALV
AERTLTGLAVLLQSQALKQALAPYCIGGPFGRLLDAEAEQLGAGKFQAFETEGLTGSAAAPAVLSYLFHR
IEGRLDGSPTLIIIDEGWLVLDSPAFAAQLREWLKTLRKKNASVVFATQSLADIETSAIAPAIIESCPTR
IFLPNERAIEPQILSVYRRFGLNDRQIEIIARAAPKRDYYCQSARGNRLFELGLGEVALAFAAASSKTDQ
LAISELTETHGTGGFARAWLRHRGLAWAADMLPPDPVPPTRSDQAAGQPKE
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c341929-339464 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGTTCAGCTTGCGCGAATACCGGAACAAGGCTGACCGACTTGCCGACTTCCTGCCCTGGGCCGCGCTGG
TCGCGCCCGGCGTGGTGCTCAACAAGGACGGCAGCTTCCAGCGCTCAGCCCGCTTCCGGGGGCCGGATCT
AGACAGTGCCACGCCGGCTGAGCTGATCGCCACCACCGCGCGCCTCAACAGCGCGCTGCGCCGCCTCGGG
TCGGGCTGGGCGATCTTCGTCGAAGCCGTGCGCCGCCCGGCGCATGACTACCCGGAAAGCGACTTCCCCG
ACGCGGCCTCGGCCCTCGTCGAGCGCGAGCGCGCAGCCCAGTTCGCCGAAGAAGGTGCCCATTTCGAGAG
CGCCTATTATCTGACCCTCGTCTGGATGCCTCCCGCCGAGGATGCCGCGCGGGCCGAGAGCTGGCTCTAT
GAAGGCAAGGCCCACCAGGGCGTGCAGGCGCGTGAACTGCTCGAGCTGTTCAGCGACCGCACCGACCGGT
TGCTGCGCCTCATCGAAGGCTTCGTGCCCGAAGCCGCCTGGCTCGACGACAGTGAGACGCTGACATACCT
CCACAGCTGCATCTCGACCCGCAATCATCGGGTGCGCGTCCCCGAGACGCCGATGCATCTCGATGCGCTG
CTGGCCGACGAACCGCTGACCGGAGGGCTCGAACCCAGGCTGGGCCGCGCCCATCTGCGCACCCTGACCG
TGGTTGGCTTTCCGAGTGCGACGTTCCCGGGCATCCTCGACGAGCTCAACTCGCAGGGCTTCGCTTACCG
CTGGTCGACTCGGGCGATCATGCTCGACAAGACCGACGCGGCGAAACTGCTGGGCAAGATCCGCCGCCAG
TGGTTCGCCAAGCGCAAGTCGGTCGCCGCGATCCTCAAGGAGGTCATGACCAACGAGGCCTCGGCGCTGC
TCGACAGCGACGCTTCGAACAAGGCCGCCGATGCCGATGCGGCACTGCAGGAACTGGGCTCGGACCTTCA
GGGCATGGCCTATGTCACGGCCACGGTCACCGTCTGGGACGAAGATGCCGCCATGGCGGCGGAAAAGCTC
CGCCTCGTCGAGAAGGTTATCCAGGGCCGCGATTTTACCGTGATCGTCGAGGGCATGAACGCGCTCGAGG
CCTGGCTCGGCTCGCTGCCCGGCCATGTCTACGCCAATGTCCGCCAGCCTCCGATCTCGACCCTGAACCT
CGCCCACATGATCCCGCTCTCGGCGGTCTGGGCCGGGCCGGAATGGGACGCCCATTTCAGGGCGCCGCCG
CTGTTTTATGCCCGCACCGAAGGCTCGACCCCGTTCCGCTTTGCACTCCATGTTGGCGATGTCGGCCATA
CGCTGATCGTCGGACCGACCGGAGCGGGCAAATCGGTGCTGCTCGCGCTGATGGCGCTGCAGTTCCGGCG
CTATGATCGCGCGCAGATTTTCGCTTTCGATTTCGGGGGCTCGATCCGGGCGGCAGCGCTCGCCTGCGGC
GGCGACTGGCAGGATCTCGGAACGAGCCTGGCAGGTGATGGCGCTGGTGCTGTCATGCTCCAGCCCCTTG
CGCGGATCGACGAGCCTGCCGAGCGCAACTGGGCGGCGGAATGGCTCCAGGCGGTCCTGACCGGCGAGGG
CGTAACCGTCGATCCGGCGACCAAGGAGCATCTCTGGTCGGCCCTGACCTCGCTCTCGACCGCGCTGGTT
GCCGAGCGCACGCTCACCGGTCTTGCCGTGCTGCTCCAGTCGCAGGCCCTGAAGCAGGCGCTCGCGCCCT
ATTGCATCGGCGGGCCCTTCGGGCGGCTCCTCGATGCCGAGGCCGAACAGCTGGGCGCAGGCAAGTTCCA
GGCTTTCGAAACCGAAGGGCTGACCGGTTCGGCCGCCGCGCCTGCCGTGCTCTCCTACCTTTTTCACCGC
ATCGAAGGCCGCCTTGATGGCTCGCCGACCCTCATCATCATCGACGAGGGCTGGCTGGTGCTCGACAGCC
CAGCCTTTGCCGCCCAGCTGCGCGAGTGGCTGAAAACGCTGCGCAAGAAGAACGCGAGCGTCGTCTTTGC
GACCCAGAGCCTTGCCGACATCGAAACCTCGGCCATCGCGCCCGCTATCATCGAAAGCTGCCCCACCCGC
ATCTTCCTGCCCAACGAACGGGCGATCGAACCGCAGATCCTGTCGGTCTATCGCCGCTTCGGCCTCAACG
ACCGGCAAATCGAGATCATCGCCCGCGCGGCCCCCAAGCGCGACTATTACTGCCAGTCGGCCCGCGGCAA
CCGCCTGTTCGAACTGGGCCTCGGCGAGGTTGCACTCGCCTTTGCCGCCGCCTCCTCGAAGACCGACCAG
CTGGCGATCAGCGAACTGACCGAGACCCATGGCACCGGAGGCTTTGCCCGCGCCTGGCTCAGGCATCGCG
GTCTCGCCTGGGCTGCCGACATGCTTCCCCCCGATCCTGTTCCCCCAACCCGCAGCGATCAAGCTGCGGG
CCAACCCAAGGAGTAG
 Primer design