SecReT4
Protein ID: 87198341
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0316
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]341936..342211 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ2GBK9
KEGG IDnar:Saro_0316
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.5e-11, Aligned region: 14..83
Protein Sequence: 91 a.a.     [Download]
>gi|87198341|ref|YP_495598.1| conjugal transfer protein TrbD [Novosphingobium aromaticivorans DSM 12444]
MEGAPSGLPLGYAVPVHRALTEHILLGGAPRGLAIANATLAGAIGLGLRLWIAGLVLFTLGHMVAVWAAR
RDPQFVDVARRHLRFPNYLRV
 
Nucleotide Sequence: 276 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c342211-341936 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGGAGGGCGCGCCGTCCGGACTGCCGCTGGGTTACGCCGTGCCCGTCCACCGGGCGCTGACCGAGCACA
TCCTGCTGGGCGGCGCGCCGCGCGGCCTGGCGATCGCCAATGCGACGCTGGCCGGAGCCATCGGGCTTGG
CCTGCGACTGTGGATCGCAGGGCTCGTGCTCTTCACGCTTGGCCACATGGTCGCGGTCTGGGCGGCCCGG
CGCGATCCGCAATTCGTCGATGTCGCGCGGCGGCATCTGCGCTTCCCCAACTACCTGAGGGTGTGA
 Primer design