SecReT4
Protein ID: 87198342
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0317
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]342211..342543 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ2GBK8
KEGG IDnar:Saro_0317
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.5e-24, Aligned region: 5..100
Protein Sequence: 110 a.a.     [Download]
>gi|87198342|ref|YP_495599.1| conjugal transfer protein TrbC [Novosphingobium aromaticivorans DSM 12444]
MTQTLARARNGASALVLAAVAALVTVMPAHAAGSSMPWEAPLQSILESIQGPVAKIVAVIIIIATGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c342543-342211 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
GTGACCCAAACCCTTGCCCGCGCCCGCAATGGCGCGTCCGCCCTCGTGCTTGCCGCTGTCGCTGCGCTGG
TCACGGTCATGCCGGCACATGCCGCCGGCTCGTCGATGCCGTGGGAAGCCCCGCTCCAGTCGATCCTCGA
ATCGATCCAGGGCCCGGTCGCCAAGATCGTCGCGGTGATCATCATCATCGCCACCGGTCTTGCACTCGCC
TTCGGTGACACCTCTGGCGGCTTCCGGCGCCTGATCCAGATCGTCTTCGGCCTGTCGATTGCCTTTGCGG
CCTCGTCCTTCTTCCTCTCCTTCTTCTCGTTCGGCGGCGGAGCGCTGGTCTGA
 Primer design