SecReT4
Protein ID: 87198343
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0318
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]342540..343523 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ2GBK7
KEGG IDnar:Saro_0318
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.8e-84, Aligned region: 26..292
FtsK_SpoIIIE [PF01580], Evalue: 3.1e-05, Aligned region: 140..176
Protein Sequence: 327 a.a.     [Download]
>gi|87198343|ref|YP_495600.1| type II secretion system protein E [Novosphingobium aromaticivorans DSM 12444]
MSVIPIRSEAATRGARMLRTALGPEIGAWLEDQAVIEVMLNPDGRLWVDRLGLGIADTGAVLSAADGERI
IRLVAHHVGAEVHSGAPRVSAELPGTGERFEGLLPPVVAAPSFAIRKPAGAVFTLADYVAAGIMPAASAD
ALAAAVAARANILVAGGTSTGKTTLTNALLAEVARTGDRVVLIEDTRELQCAAPNLVALRTKDGVASLAD
LVRSALRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGVGTIHAGSALGTLRRLEQLIQESVVTVPRALIA
ETIDVIAVLVRDGTGRRLSELVRIEGLDAAGDYRLVPLVPATEGECP
 
Nucleotide Sequence: 984 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c343523-342540 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGAGCGTCATTCCGATCCGGTCCGAGGCAGCAACGCGCGGTGCGCGCATGCTCCGCACGGCGCTCGGGC
CCGAGATCGGGGCCTGGCTGGAAGATCAGGCGGTCATCGAAGTCATGCTCAATCCTGACGGACGGCTCTG
GGTCGACCGGCTCGGGCTTGGGATTGCCGATACGGGCGCGGTGCTGTCCGCCGCCGATGGCGAGCGGATC
ATCCGCCTTGTCGCGCATCATGTGGGCGCCGAGGTGCACTCAGGCGCGCCGCGGGTCTCGGCGGAATTGC
CCGGGACGGGGGAGCGATTCGAGGGGCTGTTGCCGCCGGTGGTGGCAGCGCCCAGCTTCGCGATCCGCAA
GCCGGCCGGCGCGGTGTTCACACTGGCAGACTATGTCGCGGCCGGGATCATGCCGGCGGCATCCGCCGAT
GCTCTTGCTGCCGCGGTCGCGGCGCGGGCCAATATCCTCGTCGCGGGCGGGACGTCGACCGGCAAGACGA
CGCTGACCAATGCTCTCCTCGCCGAGGTCGCCCGGACCGGCGACCGGGTGGTGCTGATCGAGGATACGCG
CGAGCTGCAATGTGCCGCGCCCAATCTGGTGGCGCTGCGCACCAAGGATGGCGTGGCCTCGCTTGCCGAT
CTGGTGCGTTCGGCCCTGCGCCTGCGCCCTGACCGGATCCCCATCGGCGAGGTACGCGGCGCCGAGGCGC
TCGATCTCCTCAAGGCCTGGGGCACCGGGCATCCCGGCGGGGTCGGAACGATCCATGCAGGCTCTGCGCT
CGGCACGCTGCGGCGGCTCGAGCAGCTGATCCAGGAAAGCGTGGTCACGGTGCCGCGCGCCCTCATTGCC
GAGACGATTGATGTCATCGCCGTGCTCGTCCGCGACGGCACCGGTCGGCGCCTGTCCGAGCTGGTCCGCA
TCGAAGGCCTCGATGCCGCCGGTGACTACCGCCTCGTCCCCCTTGTCCCTGCAACCGAAGGAGAATGCCC
GTGA
 Primer design