SecReT4
Protein ID: 87198345
T4SS name [ID]Trb [318]
Gene symbol-
Locus tagSaro_0320
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]344157..346142 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ2GBK5
KEGG IDnar:Saro_0320
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.1e-100, Aligned region: 105..556
TraG-D_C [PF12696], Evalue: 2.4e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 1.4e-30, Aligned region: 170..536
AAA_10 [PF12846], Evalue: 1.4e-08, Aligned region: 370..477
Protein Sequence: 661 a.a.     [Download]
>gi|87198345|ref|YP_495602.1| conjugal transfer coupling protein TraG [Novosphingobium aromaticivorans DSM 12444]
MSATRILWGQIAVVLFIVVLGVWGATQWTAAALGYQPELGEPIGYAFGRPVYPPPAIFWWWFSFEAYAPQ
IFETGGLIAAASGLVAVAAAIAMSVWRARELKRTETFGSARWADRAEVAAAGLLGDHGAVLGHYEHSYLR
HDGPEHVLCFAPTRSGKGVGLVIPTLLTWPASAIIHDIKGENWNLTAGFRSTFSRVLLFDPTNANSAAYN
PLLEVRRGVAEVRDVQNIADVLVDPEGSLERRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVAAFLSDPR
RTIEATLTAMMATPHLGKAGVHPVVASAARELLNKSENERSGVLSTAMSFLGLYRDPVIAEVTRQCDWRI
MDLVSGKQPATLYLVVPPSDISRTKPLIRLILNQVGRRLTEELEADSKRHRVLLMLDEFPALGRLDFFES
ALAFMAGYGLKAFLIAQSLNQIEKAYGQNNAILDNCHVRVCFATNDERTAKRVSDSLGTATELRAMKNYA
GHRLSPWLGHLMVSRSETARALLTPGEIMQLPPDDEIVMLAGLHPIRAKKARYFKDRRLSARILPPPECR
KAQPNIANAGAWADMIVQSPTAQRHRSPTDDDDCDADNGGIRREPELPEHEEIVLPPRLVSEFEFEEPMI
EEDLAQSRQQADRIWTVARQAALDPGDGIEL
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|87198026|ref|NC_007794.1|:c346142-344157 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGTCGGCAACACGTATTCTCTGGGGTCAAATCGCAGTCGTGCTGTTTATCGTGGTCTTGGGCGTCTGGG
GAGCGACCCAATGGACGGCTGCGGCCCTCGGGTATCAGCCCGAATTGGGGGAACCAATCGGCTACGCCTT
CGGTCGTCCGGTATATCCGCCGCCTGCGATTTTCTGGTGGTGGTTCAGTTTCGAAGCCTATGCCCCGCAG
ATCTTCGAAACCGGCGGACTGATTGCTGCTGCCAGCGGATTGGTTGCCGTAGCTGCCGCGATCGCCATGT
CCGTCTGGCGCGCGCGCGAATTGAAACGGACCGAGACCTTTGGCTCCGCGCGATGGGCAGATCGGGCCGA
GGTTGCTGCCGCCGGGCTGCTGGGTGACCATGGCGCTGTCCTTGGCCATTACGAACACAGCTATCTGCGA
CATGACGGTCCGGAGCACGTTCTCTGCTTCGCGCCGACCCGCAGCGGCAAGGGCGTCGGGCTTGTCATCC
CGACCCTGCTGACCTGGCCGGCCTCGGCCATCATCCACGACATCAAGGGCGAGAATTGGAACCTCACTGC
CGGTTTCCGCTCGACGTTCAGCCGGGTGTTGCTGTTCGATCCCACAAACGCCAATTCGGCGGCCTACAAT
CCTTTGCTGGAAGTCCGGCGCGGTGTGGCCGAGGTCCGAGACGTTCAGAACATCGCAGACGTCCTGGTCG
ATCCCGAAGGTTCGCTCGAACGCCGCAATCACTGGGAAAAGACCAGCCACTCCCTGCTCGTCGGCGCGAT
CCTGCATGTGCTCTATGCCGAACCGGACAAGACCCTGGCCGGCGTGGCAGCCTTCCTATCGGACCCCCGC
CGCACCATCGAGGCGACGCTGACTGCCATGATGGCAACGCCGCATCTGGGAAAAGCCGGTGTTCATCCGG
TTGTCGCCAGCGCTGCCCGCGAACTGCTCAACAAGTCCGAGAACGAGCGATCCGGCGTTCTGTCGACGGC
CATGTCGTTTCTTGGCCTCTACCGCGACCCGGTTATCGCGGAGGTCACCCGGCAATGCGATTGGCGGATC
ATGGACCTGGTGTCGGGTAAGCAGCCGGCGACTCTCTACCTCGTGGTGCCACCGTCCGACATCAGCCGGA
CCAAGCCGCTTATCCGTCTGATCCTCAATCAGGTCGGGCGGCGCCTGACCGAAGAACTTGAGGCCGACAG
CAAGCGGCACCGCGTCCTGCTGATGCTGGACGAGTTCCCCGCGCTGGGACGGCTCGATTTCTTCGAGAGC
GCGCTGGCCTTCATGGCGGGCTATGGCCTCAAGGCTTTTCTGATCGCCCAGTCGCTGAACCAGATCGAGA
AGGCCTATGGCCAGAACAATGCCATCCTCGACAATTGCCATGTCCGGGTTTGCTTCGCTACGAACGACGA
GCGCACCGCCAAGCGGGTTTCGGACTCGCTGGGCACGGCCACGGAACTGCGGGCGATGAAGAACTACGCC
GGGCACCGCCTGTCGCCCTGGCTTGGCCACCTGATGGTGTCGCGCTCCGAAACGGCCCGGGCCTTGTTGA
CGCCGGGCGAGATCATGCAGCTACCGCCGGATGACGAGATCGTGATGCTGGCCGGGCTGCATCCGATCCG
GGCGAAGAAGGCGCGCTATTTCAAGGATCGACGACTAAGCGCCCGCATTCTGCCGCCACCGGAATGTCGT
AAGGCCCAACCGAATATCGCAAATGCCGGTGCCTGGGCGGATATGATTGTCCAGTCGCCAACAGCACAGA
GGCACCGGTCACCGACGGACGACGACGATTGTGACGCGGACAATGGCGGTATCAGGCGGGAGCCGGAACT
GCCGGAGCATGAGGAGATCGTCCTCCCCCCGCGCCTGGTCAGCGAATTCGAGTTTGAGGAACCGATGATC
GAGGAAGACCTGGCGCAGAGCCGGCAGCAAGCTGACCGCATTTGGACCGTTGCCCGGCAGGCGGCGCTTG
ACCCTGGCGACGGGATCGAACTGTGA
 Primer design