SecReT4
Protein ID: 87200172
T4SS name [ID]Tra_F [555]
Gene symbol-
Locus tagSaro_2156
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]2295560..2295847 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ2G6C8
KEGG IDnar:Saro_2156
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.2e-35, Aligned region: 4..94
Protein Sequence: 95 a.a.     [Download]
>gi|87200172|ref|YP_497429.1| hypothetical protein Saro_2156 [Novosphingobium aromaticivorans DSM 12444]
MADPYIVPRRLDDPELIGFWTIDEFAGMLAPFTWGILTQQIFIGIIVAFGAWFALRKAKAGRASSWVAHA
AYWYLPAGFLGLKATPPSHCRLLAG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|87198026|ref|NC_007794.1|:2295560-2295847 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGGCAGACCCTTACATCGTTCCTCGGCGGCTCGATGACCCGGAGCTTATCGGCTTTTGGACCATCGACG
AGTTCGCGGGAATGCTGGCCCCCTTCACCTGGGGGATCCTCACCCAGCAAATCTTTATCGGCATCATAGT
CGCCTTCGGCGCCTGGTTCGCATTGCGAAAGGCAAAAGCAGGACGCGCCAGCTCCTGGGTAGCCCACGCC
GCATACTGGTATCTGCCAGCAGGATTTCTGGGCCTCAAGGCAACGCCGCCTTCTCACTGCCGACTACTCG
CCGGTTGA
 Primer design