SecReT4
Protein ID: 87200181
T4SS name [ID]Tra_F [555]
Gene symbol-
Locus tagSaro_2165
StrainNovosphingobium aromaticivorans DSM 12444
Repliconchromosome [GenBank: NC_007794] [Browse all T4SS(s) in this replicon]
Location [Strand]2303603..2304127 [+]
ProductType IV secretory pathway protease TraF-like
Component typeTraF_F
UniProt IDQ2G6B9
KEGG IDnar:Saro_2165
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.7e-16, Aligned region: 41..174
Protein Sequence: 174 a.a.     [Download]
>gi|87200181|ref|YP_497438.1| Type IV secretory pathway protease TraF-like [Novosphingobium aromaticivorans DSM 12444]
MLPADLLIRSASARRLVLWGGLGAGALALSSLAAFAQGHALMINVSPSLPYWAIWVTRGAPVHRGDIILF
DPPTSPLLVKHFGAKPKPFGKRVSGVPGDIITEQNRIYFVNGEAVAKAKLESRLGEPLALGPTGRVPKGC
YFVTSEHKDGFDSRYAAIGWICGPRILGVGRPIL
 
Nucleotide Sequence: 525 bp     [Download]
>gi|87198026|ref|NC_007794.1|:2303603-2304127 Novosphingobium aromaticivorans DSM 12444 chromosome, complete genome
ATGCTGCCCGCTGATCTCTTGATCCGCTCAGCTTCGGCGCGCCGGCTCGTGCTTTGGGGCGGGCTCGGCG
CCGGGGCACTGGCGCTCTCCTCGCTTGCCGCCTTCGCGCAGGGCCATGCGCTTATGATCAATGTGAGCCC
CAGCCTGCCCTACTGGGCCATCTGGGTCACGCGGGGGGCACCCGTGCATCGCGGGGACATTATCCTGTTC
GACCCGCCCACCTCGCCTTTGTTGGTCAAGCATTTCGGGGCGAAGCCCAAGCCGTTCGGCAAGCGGGTGA
GCGGTGTTCCGGGCGACATCATCACCGAGCAAAACCGCATCTACTTCGTCAACGGTGAGGCCGTGGCCAA
GGCCAAGCTTGAGAGCCGCCTCGGCGAACCGCTGGCGCTTGGACCTACGGGGCGCGTGCCGAAAGGCTGC
TACTTCGTCACCAGCGAACACAAGGATGGCTTTGACAGCCGCTATGCCGCGATCGGTTGGATCTGTGGAC
CGCGCATACTCGGGGTCGGGAGGCCAATCCTGTGA
 Primer design