SecReT4
Protein ID: 88607229
T4SS name [ID]VirB [503]
Gene symbolvirB11
Locus tagAPH_1403
StrainAnaplasma phagocytophilum HZ
Repliconchromosome [GenBank: NC_007797] [Browse all T4SS(s) in this replicon]
Location [Strand]1462472..1463470 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ2GIA6
KEGG IDaph:APH_1403
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.1e-87, Aligned region: 13..312
Protein Sequence: 332 a.a.     [Download]
>gi|88607229|ref|YP_505895.1| type IV secretion system ATPase VirB11 [Anaplasma phagocytophilum HZ]
MTGGGAALETYLEPLRDIFAEEGVNEISINNSCEVWVENRGNIRCEHIAALTTSHLRGLGRLIAQATEQK
LSEETPLLSASLPNGFRVQVVFPPACEGDKIVMSIRKPSAMQLSLDDYEKMGAFSHVAQQNDKLRDENSE
LGELLSKGKIKEFLETAVQKKKNIIVSGGTSTGKTTFTNAALRAIPLEERIITVEDSREIVLSHPNRVHL
LASKGGQGRARVGTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPRMAIEQLK
LMVIQAGTGLPADQIVNYIMNIVDVIVQLKRSSGGVRHVSDILFTKCSEGNK
 
Nucleotide Sequence: 999 bp     [Download]
>gi|88606690|ref|NC_007797.1|:c1463470-1462472 Anaplasma phagocytophilum HZ, complete genome
ATGACTGGGGGTGGTGCAGCTTTAGAAACTTATCTTGAACCGCTTCGGGATATATTTGCTGAAGAAGGAG
TAAATGAAATATCAATAAATAACTCATGTGAAGTATGGGTTGAAAATAGGGGAAATATTAGGTGCGAGCA
TATTGCAGCATTGACGACTTCTCATCTCAGGGGGTTAGGGCGTCTTATTGCTCAGGCTACGGAGCAAAAG
TTAAGTGAGGAAACGCCACTGCTTTCTGCGTCTTTACCCAACGGGTTTCGTGTACAGGTAGTTTTTCCTC
CGGCATGTGAGGGTGATAAGATAGTGATGTCGATTCGTAAGCCTTCTGCGATGCAGTTGTCGCTTGATGA
TTATGAAAAAATGGGGGCATTTTCTCATGTTGCTCAGCAGAATGACAAGCTCAGAGATGAAAATAGCGAA
TTAGGTGAGTTGCTATCTAAGGGTAAAATAAAGGAATTTTTAGAAACGGCGGTACAAAAAAAGAAGAATA
TAATTGTGAGTGGTGGTACCTCTACAGGGAAGACTACATTTACTAACGCTGCCTTGAGAGCTATACCTTT
AGAAGAGAGGATTATTACTGTTGAAGACTCGAGGGAAATTGTCCTATCTCATCCAAATCGCGTACATTTA
CTTGCTTCTAAAGGTGGGCAAGGTAGAGCACGTGTTGGTACGCAAGATTTGATCGAAGCATGTCTTCGTC
TTCGTCCGGATAGGATTATAGTGGGGGAGTTGAGGGGTGCTGAAGCCTTTAGTTTTTTGAGGGCTATTAA
TACTGGGCATCCTGGATCTATTTCTACGTTGCACGCTGATACTCCAAGGATGGCTATAGAGCAGTTAAAG
CTTATGGTAATACAGGCAGGAACGGGATTACCAGCAGATCAGATTGTGAATTACATAATGAATATTGTGG
ATGTGATAGTGCAGCTGAAGAGGAGCTCTGGTGGAGTGCGCCATGTTTCAGACATTTTGTTCACTAAGTG
TTCAGAGGGTAATAAGTAA
 Primer design