SecReT4
Protein ID: 88607785
T4SS name [ID]VirB [503]
Gene symbolvirD4
Locus tagAPH_1402
StrainAnaplasma phagocytophilum HZ
Repliconchromosome [GenBank: NC_007797] [Browse all T4SS(s) in this replicon]
Location [Strand]1460198..1462420 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ2GIA7
KEGG IDaph:APH_1402
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.5e-151, Aligned region: 123..566
TraG-D_C [PF12696], Evalue: 2.2e-26, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 1.2e-25, Aligned region: 239..542
AAA_10 [PF12846], Evalue: 7.6e-05, Aligned region: 290..482
Protein Sequence: 740 a.a.     [Download]
>gi|88607785|ref|YP_505894.1| type IV secretion system component VirD4 [Anaplasma phagocytophilum HZ]
MHSSNHIRNILVFFCGLFCLLEFCFYISGVLFVLLVWGVDYLDFNAINPSVSDFPMRLWPTIFQYISKWW
GDPKLFGIANSLKLWGSFFAPIGLVCLVAWNLRHVLIDWRPFKKKESLHGDSRWASERDIRKIGLRSRRG
ILLGKDQRGYLVADGYQHALLFAPTGSGKGVGFVIPNLLFWEDSVIVHDVKLENYDLTSGWRKKIGQEVY
VWNPAQPDGISHCYNPLDWISKKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVKSF
GEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDTATA
SSDFNIQDFKRKRVSVYVGVTPDNLTRLRPLMQVFYQQATEFLCRTLPSDDEPYGVLFLMDEFPTLGKME
QFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVSQ
ESLNRPKFLDLNPASRSLHISDTQRALLLPQEVIMLPKDEQILLIESTYPIKSRKIKYFEDKTFTRRLLK
STFIPTQEPYDPEKIRGGVEGEAGIVSEASENSEDLKALMGSSSAENPPERAEYGYEDDGDLVDREEFED
LYGIGEEPEDDLEDLDESDDYFHDEDDVLNDEDYDDPYEDDMELEGDGDWDENEAFEDELLDDEVVDDEF
DSLEPEEDEDFEEDDSLEEEDEFGEDRPTDDNDSSNGRLK
 
Nucleotide Sequence: 2223 bp     [Download]
>gi|88606690|ref|NC_007797.1|:c1462420-1460198 Anaplasma phagocytophilum HZ, complete genome
ATGCATAGTTCCAATCATATACGAAATATTTTGGTATTCTTTTGTGGGCTGTTTTGCCTGTTGGAGTTTT
GCTTTTATATTTCTGGCGTATTATTTGTGCTTCTTGTATGGGGAGTAGATTATTTAGATTTTAATGCAAT
AAACCCCAGTGTGTCAGATTTTCCCATGCGGCTGTGGCCGACTATTTTTCAGTATATTAGTAAATGGTGG
GGGGATCCCAAGCTGTTTGGAATTGCTAATTCGCTAAAGTTGTGGGGTTCATTTTTTGCTCCTATTGGTC
TTGTTTGTCTTGTGGCGTGGAATCTTCGACATGTTCTTATTGATTGGCGACCTTTTAAGAAGAAAGAATC
TTTACACGGAGATTCTCGGTGGGCTTCAGAGCGGGATATTAGAAAAATAGGGTTACGCAGCAGACGTGGA
ATTTTATTAGGGAAAGATCAGAGGGGTTATTTGGTAGCAGATGGCTATCAACATGCTCTTCTTTTTGCTC
CAACTGGGTCTGGTAAAGGTGTAGGGTTTGTAATTCCCAATCTTTTATTCTGGGAAGATTCTGTAATTGT
GCATGATGTGAAGCTTGAAAACTACGACCTCACGAGTGGTTGGCGTAAGAAAATTGGGCAGGAAGTATAT
GTATGGAATCCTGCGCAGCCAGATGGTATCAGTCATTGTTATAATCCGCTGGATTGGATAAGCAAAAAAC
CTGGGCAGATGGTAGATGACGTACAGAAGATTGCTAACCTTATCATGCCGGAGCAAGACTTTTGGTACAA
CGAAGCAAGGAGTTTATTTGTTGGGGTGGTGCTCTATTTATTGGCAGTTCCGGAAAAGGTTAAGTCATTT
GGCGAAGTTGTAAGAACAATGCGTAGCGATGACGTAGTATATAACCTTGCGGTTGTATTGGACACGATAG
GTAAGAAAATACACCCTGTTGCGTACATGAACATTGCTGCATTCTTGCAGAAGGCGGATAAGGAACGTTC
TGGTGTTATTTCTACCATGAACTCTTCTTTGGAATTGTGGGCTAACCCTCTTATTGATACTGCAACAGCT
TCTAGTGATTTTAATATACAAGATTTCAAGAGGAAGCGTGTTTCTGTGTATGTTGGAGTTACACCTGATA
ATCTCACTAGGTTAAGGCCTTTGATGCAGGTTTTTTATCAACAGGCAACGGAGTTTTTATGTCGTACTCT
ACCTTCTGATGATGAACCTTATGGTGTATTGTTTTTGATGGATGAGTTTCCAACTCTTGGAAAGATGGAG
CAGTTCCAGACGGGGATAGCTTACTTTCGTGGGTACAGGGTAAGATTATTTTTGATAATACAAGATACAG
AACAGTTAAAGGGAATATACGAAGAAGCAGGGATGAACTCTTTCCTATCTAATTCTACTTACCGTATAAC
TTTTGCTGCAAACAACATAGAGACTGCAAACTTGATATCGCAACTTATTGGAAATAAGACCGTGAGTCAG
GAGTCTCTAAATAGGCCTAAGTTTTTAGACCTTAATCCTGCTTCACGCTCACTGCATATTTCTGATACAC
AGCGGGCGTTGTTGTTGCCTCAGGAAGTTATAATGTTACCTAAGGATGAGCAAATTCTCTTAATTGAATC
TACTTATCCGATAAAGTCTAGAAAAATAAAGTACTTTGAAGATAAAACGTTTACGCGTAGGCTATTGAAG
AGCACGTTTATTCCTACGCAAGAGCCGTACGATCCTGAAAAGATTCGTGGTGGAGTCGAGGGGGAAGCAG
GTATTGTGTCTGAGGCTTCGGAGAATAGTGAAGATCTAAAGGCGTTGATGGGTAGTTCTAGTGCAGAAAA
TCCTCCTGAGCGTGCTGAATATGGATATGAAGATGATGGTGATCTTGTGGACAGAGAAGAATTTGAAGAC
CTATACGGTATAGGTGAAGAACCTGAAGATGATTTAGAGGACTTGGATGAGTCTGATGATTACTTTCACG
ACGAAGATGATGTTCTTAATGATGAAGACTACGACGATCCTTATGAAGATGACATGGAGTTAGAAGGGGA
CGGAGATTGGGATGAGAATGAAGCTTTTGAGGATGAGCTTTTAGATGATGAGGTTGTTGACGACGAGTTT
GATAGCTTAGAGCCAGAGGAGGACGAAGACTTTGAAGAAGATGATTCTTTAGAAGAAGAGGATGAATTTG
GAGAAGATCGACCTACTGATGACAATGATAGCAGTAACGGAAGACTAAAGTAG
 Primer design