SecReT4
Protein ID: 88607942
T4SS name [ID]VirB [503]
Gene symbolvirB8
Locus tagAPH_1406
StrainAnaplasma phagocytophilum HZ
Repliconchromosome [GenBank: NC_007797] [Browse all T4SS(s) in this replicon]
Location [Strand]1465674..1466390 [-]
Producttype IV secretion protein VirB8
Component typeVirB8
UniProt IDQ2GIA3
KEGG IDaph:APH_1406
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.5e-54, Aligned region: 30..236
Protein Sequence: 238 a.a.     [Download]
>gi|88607942|ref|YP_505898.1| type IV secretion protein VirB8 [Anaplasma phagocytophilum HZ]
MVLDMFGLGKEKKKPVTGSERDCVSGKIGDWYHDRYGSVVVQRNILLLLVVLSVFCIAVSTFVIFRIGKT
RTIEPFVVEIEKKSGITTLVNPMTVKQYSADEVLSNYFIVEYIKARELYDPNNFQYNYYTRVRLLSSQET
YSEFRSWIRPSNPSSPMTLYSDVVSGALKVRSLQHLEGGQVQVRFTMEFVNHSGSIVKRDRIATLSFRYS
SLEMTEQDRQVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 717 bp     [Download]
>gi|88606690|ref|NC_007797.1|:c1466390-1465674 Anaplasma phagocytophilum HZ, complete genome
TTGGTATTGGATATGTTTGGTCTTGGAAAGGAAAAAAAAAAGCCCGTGACAGGTTCTGAGCGCGATTGCG
TGTCGGGAAAGATCGGAGATTGGTATCATGACAGATACGGTTCCGTGGTCGTGCAGCGCAATATACTCCT
TCTTCTTGTAGTGTTGTCGGTATTTTGTATCGCTGTAAGTACTTTCGTCATTTTCAGAATAGGGAAAACA
AGAACAATAGAACCCTTCGTTGTAGAAATAGAAAAGAAGTCAGGGATTACAACGCTAGTAAACCCGATGA
CTGTAAAACAGTATTCTGCCGACGAGGTATTAAGTAATTATTTTATAGTGGAGTACATAAAGGCTCGTGA
GCTCTATGATCCCAACAATTTCCAGTATAACTACTATACGAGAGTACGTCTCCTTTCGTCCCAAGAAACC
TATAGCGAGTTTCGTAGTTGGATACGTCCTAGTAACCCTTCTAGTCCTATGACGCTTTATTCGGATGTTG
TATCAGGAGCTCTAAAAGTGCGCTCTCTGCAACATCTAGAAGGAGGGCAGGTTCAGGTGCGGTTTACTAT
GGAATTCGTTAATCATAGCGGCTCGATTGTAAAGAGAGATAGAATTGCTACTCTTTCCTTTAGGTATTCC
TCTCTTGAGATGACTGAACAAGATAGACAGGTGAACCCTTTGGGCTTCCAGATCACTTACTATAGGGCGG
ATGATGAATTTCTATAA
 Primer design