SecReT4
Protein ID: 88608007
T4SS name [ID]VirB [504]
Gene symbolvirD4
Locus tagNSE_0739
StrainNeorickettsia sennetsu str. Miyayama
Repliconchromosome [GenBank: NC_007798] [Browse all T4SS(s) in this replicon]
Location [Strand]658571..660496 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ2GD31
KEGG IDnse:NSE_0739
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-143, Aligned region: 120..559
TraG-D_C [PF12696], Evalue: 2.3e-26, Aligned region: 403..525
TrwB_AAD_bind [PF10412], Evalue: 1.3e-23, Aligned region: 234..539
AAA_10 [PF12846], Evalue: 3.4e-05, Aligned region: 356..480
Protein Sequence: 641 a.a.     [Download]
>gi|88608007|ref|YP_506615.1| type IV secretion system component VirD4 [Neorickettsia sennetsu str. Miyayama]
MRQLRNIITIFFLLAFIFALALYMSAAIFVVAVWGIEHLNFRDLQPSLDGFPTRLWPTIFVYISDLFNNW
DAWAPAVKIKLAVSLGIPFGILGVVFYMLRAPIMEWRPFKKKESVHGDARWATEREIRKIGLRSRKGILL
GKDKKGFLIAGGFQHALLFAPTGSGKGVGFVIPNLLFWEDSVVVHDIKLENFTLTSGYRKKMGQKVYCWS
PADPDGKSHCYNPLDWVSSKPGQMVDDVQKIANLLMPEQDFWVNEARSLFLGVVLYILAVPEKVKSFGEV
VRVMRSDDVTYSLAVALDTMGKKIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDTTTATSD
FNFMKFKRELTTVYVGLTPDNLTRLQPLMQVFYQQATEFLCRHLPQKDEPYGVLFMMDEFPTLGEMEQFK
TGIAYFRGYNVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLVGNKTVAQESL
NKPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDQQILLIESTYPIKSKKIRYFEDSFFTKKILDPIS
IPTQEPFDPKKFEEKMRKEREAKELEENAPLAIDEDQALLEDESLLDDSDYEDGDFEDLDEEEDLSDFLD
DTDEENEENMV
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|88607955|ref|NC_007798.1|:c660496-658571 Neorickettsia sennetsu str. Miyayama chromosome, complete genome
ATGAGACAGCTTAGGAATATTATAACGATATTTTTTCTTCTGGCGTTCATTTTTGCCTTGGCCCTTTACA
TGTCAGCGGCTATTTTTGTGGTTGCAGTTTGGGGAATAGAACACCTCAATTTCCGTGATTTGCAACCATC
TTTGGACGGGTTTCCTACACGTCTTTGGCCTACAATTTTTGTCTATATAAGTGATCTTTTCAATAATTGG
GATGCTTGGGCCCCAGCTGTAAAGATAAAACTTGCTGTCTCGTTAGGCATTCCGTTTGGAATACTCGGAG
TCGTTTTTTATATGCTCCGTGCACCGATTATGGAGTGGCGCCCATTCAAGAAGAAAGAATCTGTGCACGG
TGATGCAAGGTGGGCAACAGAAAGGGAAATAAGGAAAATCGGGCTTAGAAGTCGTAAAGGGATACTGCTT
GGTAAAGATAAGAAAGGTTTCCTCATTGCAGGGGGGTTTCAACACGCTTTACTGTTCGCTCCAACTGGTT
CTGGGAAGGGTGTTGGGTTTGTTATCCCAAATCTTCTCTTCTGGGAAGATTCTGTTGTTGTTCACGATAT
CAAACTTGAGAACTTCACCTTAACTAGCGGTTATAGGAAAAAGATGGGTCAGAAGGTCTATTGTTGGAGT
CCAGCTGATCCAGATGGTAAAAGTCACTGCTATAATCCGTTGGATTGGGTTAGTTCAAAGCCGGGGCAGA
TGGTAGATGATGTTCAGAAAATCGCTAACCTCCTAATGCCCGAACAAGATTTCTGGGTCAATGAAGCCCG
AAGTCTTTTTCTGGGGGTAGTACTGTACATTCTTGCGGTACCAGAAAAGGTAAAGTCCTTTGGAGAGGTG
GTAAGGGTGATGAGAAGCGATGATGTTACGTATAGTCTCGCTGTTGCGTTAGATACAATGGGTAAAAAGA
TTCACCCAGTTGCCTATATGAACATTGCTGCTTTTCTTCAAAAGGCAGACAAAGAAAGATCTGGTGTGAT
ATCGACAATGAACTCCTCGCTCGAATTATGGGCAAACCCACTTATTGATACCACGACGGCTACTAGTGAC
TTTAATTTTATGAAGTTCAAAAGAGAACTTACGACGGTGTATGTGGGCCTCACACCAGACAACTTGACGA
GATTACAGCCGCTTATGCAGGTTTTTTATCAACAAGCAACAGAGTTTTTGTGTAGGCATCTTCCACAAAA
AGACGAACCATATGGTGTTTTGTTTATGATGGACGAGTTTCCTACCCTTGGTGAGATGGAGCAGTTTAAA
ACTGGTATTGCATATTTTCGTGGATATAACGTACGTCTGTTTCTTATCATCCAAGATACAGAGCAGCTAA
AAGGTATCTACGAGGAAGCAGGGATGAACTCTTTTCTCTCGAACTCTACCTACAGAATTACTTTTGCTGC
AAACAACATAGAAACGGCAAATTTAATTTCGCAGTTGGTTGGTAATAAGACAGTTGCACAGGAATCGCTT
AACAAACCGAAGTTTCTTGACTTGAATCCTGCATCGAGGTCGCTGCATATTTCCGAGACTCAGCGTGCGC
TTCTGTTGCCTCAGGAGGTGATAATGTTGCCGCGTGACCAGCAGATCCTATTGATTGAATCTACTTATCC
TATCAAATCAAAAAAGATACGGTATTTCGAAGATAGTTTTTTCACGAAAAAAATCCTCGATCCTATTTCT
ATCCCGACCCAGGAACCATTTGATCCCAAAAAATTTGAAGAAAAGATGCGTAAGGAAAGGGAGGCTAAGG
AATTAGAAGAGAATGCTCCATTGGCTATAGATGAAGATCAAGCGCTTCTTGAAGACGAGTCTCTTTTGGA
TGATTCCGATTATGAAGATGGAGACTTTGAGGATCTAGATGAAGAAGAGGATCTGTCCGATTTTTTAGAT
GACACGGACGAAGAGAACGAAGAAAACATGGTATGA
 Primer design