SecReT4
Protein ID: 88608308
T4SS name [ID]VirB [504]
Gene symbolvirB11
Locus tagNSE_0740
StrainNeorickettsia sennetsu str. Miyayama
Repliconchromosome [GenBank: NC_007798] [Browse all T4SS(s) in this replicon]
Location [Strand]660527..661522 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ2GD30
KEGG IDnse:NSE_0740
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.3e-87, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|88608308|ref|YP_506616.1| type IV secretion system ATPase VirB11 [Neorickettsia sennetsu str. Miyayama]
MQYTALNKYLEPLDALFQDSDVNEISINKPGEVWIEKKGEIMRSELPELDFQHLKGLAKLVAQATEQNVS
GEFPLLSASLPNECRIQLALPPVAEAGTVVISIRKPSSIQLSLGDYEAMGAFEKLKCRDVSLDIDNRLRE
LLKGGDVKSFLELAIKEKKNIIISGGTSTGKTTFTNSLLREIPIYERIITVEDAREVVLSKHPNRVHLVA
SKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADAPKMAIEQLKLM
VMQAGLGIPPVQIKEYIMNVVDVIVQLKRAGHGKRFVSEILLTKDLLESGS
 
Nucleotide Sequence: 996 bp     [Download]
>gi|88607955|ref|NC_007798.1|:c661522-660527 Neorickettsia sennetsu str. Miyayama chromosome, complete genome
ATGCAATACACAGCCCTGAATAAATACCTGGAGCCCTTGGATGCACTATTTCAGGATAGTGATGTCAACG
AGATCTCGATCAATAAACCCGGGGAGGTGTGGATCGAAAAGAAGGGTGAGATTATGAGATCTGAACTTCC
TGAGCTTGACTTTCAACACCTTAAAGGACTTGCGAAATTGGTTGCTCAAGCCACAGAGCAAAATGTAAGT
GGAGAGTTTCCACTTCTCTCTGCTTCTCTGCCAAATGAATGTCGGATCCAGTTGGCTTTGCCACCCGTTG
CAGAGGCGGGGACGGTTGTAATTTCAATAAGGAAACCTAGCAGTATACAATTGTCTCTTGGTGATTATGA
GGCAATGGGCGCATTTGAGAAACTTAAGTGTCGTGATGTTTCACTTGATATAGATAATCGCCTCCGCGAG
CTCTTGAAGGGTGGTGATGTGAAAAGTTTCCTCGAACTTGCGATAAAAGAGAAAAAGAACATCATCATCA
GCGGTGGTACATCGACTGGTAAGACAACTTTTACTAATAGTCTGCTTCGCGAAATACCGATTTATGAAAG
AATTATCACGGTCGAAGATGCTCGGGAGGTAGTGTTGTCTAAGCATCCGAATAGGGTGCATTTAGTTGCC
TCAAAGGGTGGACAGGGTCGTGCCAATGTTACAACTCAGGATCTGATAGAGGCGTGCCTGCGTCTTCGTC
CTGATAGAATTATAGTTGGTGAATTAAGGGGTGCGGAGGCTTTTAGTTTTCTTAGGGCTATTAATACAGG
GCATCCGGGCTCGATTTCCACTTTGCATGCGGATGCCCCAAAGATGGCCATAGAGCAACTGAAACTTATG
GTAATGCAGGCCGGTTTGGGAATTCCTCCTGTGCAAATTAAGGAATATATAATGAATGTGGTAGATGTTA
TTGTTCAGCTCAAAAGAGCGGGTCATGGGAAGAGATTTGTTTCTGAGATCTTGCTTACCAAGGATTTGCT
TGAGAGTGGTAGTTGA
 Primer design