SecReT4
Protein ID: 88608885
T4SS name [ID]VirB [504]
Gene symbolvirB8-2
Locus tagNSE_0743
StrainNeorickettsia sennetsu str. Miyayama
Repliconchromosome [GenBank: NC_007798] [Browse all T4SS(s) in this replicon]
Location [Strand]663617..664294 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ2GD27
KEGG IDnse:NSE_0743
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.9e-50, Aligned region: 15..223
Protein Sequence: 225 a.a.     [Download]
>gi|88608885|ref|YP_506619.1| type IV secretion system protein VirB8 [Neorickettsia sennetsu str. Miyayama]
MVRFFKSKSEAKQKVAHWYEEHVGRVTLQRNFLVVLNLGVIVALMLVVFALFAVSSSRTIEAFVIEVSKK
TGTIARVNPATVKEYSANRAITNYFVTQYVKAREVFHPATYRYDYYTTVRVFSDPSLYTLFKGSLSLSNP
TSPLNLYANVADSKYEVRSIRHLDSDTVQMRITMRFVNSDGGVSVTNKIVSVRYSYMDLDLSEEDRRLNP
LGFVVVSYQVDDDHS
 
Nucleotide Sequence: 678 bp     [Download]
>gi|88607955|ref|NC_007798.1|:c664294-663617 Neorickettsia sennetsu str. Miyayama chromosome, complete genome
ATGGTGAGGTTTTTCAAAAGCAAAAGCGAAGCGAAACAAAAGGTGGCCCACTGGTACGAGGAGCACGTAG
GACGGGTTACTCTGCAAAGGAACTTTCTTGTGGTGCTGAACTTGGGGGTCATAGTAGCCCTTATGTTAGT
TGTTTTTGCTTTGTTTGCGGTTAGTAGTTCAAGAACAATAGAGGCTTTTGTGATCGAAGTTTCCAAGAAA
ACCGGAACTATAGCACGCGTCAATCCTGCTACGGTAAAGGAGTATTCTGCAAACAGGGCAATAACGAATT
ATTTTGTTACGCAGTATGTAAAGGCAAGGGAGGTTTTTCATCCTGCAACGTATCGTTACGATTACTACAC
CACAGTGAGAGTATTTTCAGATCCTAGCCTTTATACGCTGTTTAAGGGATCTCTCTCCTTAAGTAATCCT
ACAAGTCCGCTCAACTTATACGCTAATGTAGCGGATTCTAAATACGAGGTTCGCTCCATAAGACATCTAG
ACAGTGATACGGTTCAGATGAGAATTACTATGAGATTTGTAAATAGTGATGGTGGAGTGAGTGTCACAAA
TAAGATTGTGTCTGTCAGATACAGTTATATGGATCTTGATCTTTCAGAAGAGGATAGGCGCCTCAATCCT
CTTGGTTTTGTTGTTGTTTCTTATCAGGTAGATGATGATCATTCGTGA
 Primer design