SecReT4
Protein ID: 88657566
T4SS name [ID]VirB [493]
Gene symbolvirD4
Locus tagECH_0040
StrainEhrlichia chaffeensis str. Arkansas
Repliconchromosome [GenBank: NC_007799] [Browse all T4SS(s) in this replicon]
Location [Strand]36100..38244 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ2GI61
KEGG IDech:ECH_0040
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.4e-152, Aligned region: 125..569
TraG-D_C [PF12696], Evalue: 9.1e-27, Aligned region: 408..530
TrwB_AAD_bind [PF10412], Evalue: 3.9e-26, Aligned region: 241..544
Protein Sequence: 714 a.a.     [Download]
>gi|88657566|ref|YP_506872.1| type IV secretion system protein VirD4 [Ehrlichia chaffeensis str. Arkansas]
MDSVSANHIRNILFLVLGAFFGLEFCFYLSGVLFILMVWGPDYLDFNAINPSFSDFPDRIWPTVFNYVEH
WWHNPSSYDAILLVKLISSLCIPIGILSIVLWNLRNILFDWRPFKKKESLHGDSRWATEKDIRKIGLRSR
KGILLGKDKRGYLIADGFQHALLFAPTGSGKGVGFVIPNLLFWEDSVIVHDIKLENYDLTSGWRKKRGQE
VFVWNPAQPDGVSHCYNPLDWISSKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVK
SFGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTA
TASSDFNIQEFKRKKVTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRTLPSDDEPYGVLFLMDEFPTLGK
MEQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTV
NQESLNRPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDEQILLIESTYPIKSKKIKYYEDKNFTKKL
LKSTFVPTQEPYDPNNVKITKKENEDPIPSIESDIPENKPNNTENNLTEEGAIYNSTETNYEDDEDEDDD
FNFDDLDEYIDEDEEYSEQPEEDYDYTDEEDEDEEEDEEDNDYNNSNEDDDYENNNISNSHHENDFDNHN
EKPVKDQDIKNDKQ
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|88657561|ref|NC_007799.1|:c38244-36100 Ehrlichia chaffeensis str. Arkansas, complete genome
ATGGATAGTGTAAGTGCAAACCACATACGTAATATTTTATTCCTGGTCTTAGGAGCATTCTTCGGGTTGG
AATTTTGCTTTTATCTATCAGGGGTTTTATTTATCTTAATGGTATGGGGACCAGACTATCTAGATTTCAA
CGCTATAAATCCTAGTTTCAGCGACTTTCCAGACAGAATTTGGCCTACTGTTTTTAATTACGTAGAACAC
TGGTGGCATAATCCTTCTTCATACGATGCAATACTATTAGTAAAGTTAATATCATCACTATGTATACCAA
TAGGTATCCTAAGTATAGTATTGTGGAATTTAAGAAACATACTATTCGATTGGAGACCATTTAAAAAGAA
AGAATCATTACATGGAGATTCAAGATGGGCAACAGAAAAAGATATTCGAAAAATAGGATTACGTAGTAGA
AAAGGTATACTACTAGGAAAAGACAAAAGAGGTTATCTTATTGCTGATGGATTTCAACATGCTTTACTAT
TTGCACCAACCGGATCTGGGAAAGGTGTAGGTTTTGTAATACCAAACTTATTGTTTTGGGAAGACTCTGT
AATAGTACATGACATAAAATTAGAAAACTATGATCTCACAAGTGGATGGAGGAAAAAAAGAGGACAAGAA
GTATTTGTGTGGAATCCAGCTCAACCTGATGGGGTAAGTCACTGTTACAATCCATTGGATTGGATAAGCT
CTAAACCAGGACAAATGGTGGATGATGTACAAAAAATCGCCAATCTAATAATGCCTGAACAAGACTTTTG
GTACAACGAAGCACGTAGTTTATTTGTAGGAGTAGTATTATATCTACTAGCAGTACCAGAAAAAGTAAAA
TCCTTTGGAGAAGTTGTACGAACAATGCGTAGTGATGACGTAGTCTACAACTTGGCAGTTGTATTAGACA
CTATAGGGAAAAAAATTCACCCAGTTGCATATATGAATATAGCTGCATTCTTACAAAAAGCTGATAAAGA
GCGTTCAGGTGTAGTATCAACTATGAACTCATCTTTAGAATTATGGGCAAACCCGTTAATAGATACAGCA
ACAGCTTCAAGTGATTTTAATATTCAAGAATTTAAAAGAAAAAAAGTAACAGTATATGTTGGATTAACAC
CAGACAACTTAACTCGTCTTAGGCCTTTAATGCAGGTATTCTATCAGCAAGCAACAGAGTTTTTATGTCG
AACTTTACCATCGGATGATGAACCTTACGGTGTATTGTTTTTAATGGATGAGTTTCCAACATTAGGAAAG
ATGGAGCAATTTCAAACTGGTATTGCATATTTCCGTGGATATAGAGTTAGATTATTTTTGATTATCCAAG
ACACTGAACAGCTTAAAGGTATATATGAGGAAGCAGGAATGAACTCATTTCTGTCAAATTCTACTTATAG
AATTACTTTTGCAGCAAACAATATTGAAACTGCAAACCTAATATCACAGCTAATAGGCAATAAAACAGTT
AATCAGGAATCTTTAAATAGACCTAAATTTTTAGATTTAAACCCTGCCTCTCGTTCATTACACATATCAG
AAACACAAAGAGCGTTATTATTACCTCAAGAAGTTATAATGTTACCTAGAGATGAACAAATACTTTTAAT
AGAGTCTACTTATCCTATAAAATCAAAAAAAATAAAATATTATGAAGACAAAAACTTTACAAAAAAATTA
TTGAAAAGCACTTTCGTACCTACTCAAGAACCTTACGATCCTAATAATGTAAAAATAACAAAAAAAGAAA
ATGAAGACCCTATCCCTAGTATTGAAAGTGATATTCCTGAAAACAAACCTAACAACACTGAAAATAATCT
AACAGAAGAAGGTGCTATATATAACAGTACAGAAACAAATTATGAAGATGATGAAGACGAAGATGATGAT
TTTAACTTCGATGATTTAGATGAGTACATAGATGAAGATGAAGAGTACAGCGAACAGCCTGAAGAAGACT
ATGACTATACCGATGAAGAAGATGAAGATGAAGAAGAAGATGAAGAAGACAACGATTACAACAATAGTAA
TGAAGATGATGACTATGAAAATAATAATATAAGCAACTCACACCATGAAAATGATTTTGACAATCACAAT
GAAAAACCTGTCAAGGATCAAGATATAAAAAATGATAAACAGTAA
 Primer design