SecReT4
Protein ID: 88657917
T4SS name [ID]VirB [493]
Gene symbolvirB8-1
Locus tagECH_0044
StrainEhrlichia chaffeensis str. Arkansas
Repliconchromosome [GenBank: NC_007799] [Browse all T4SS(s) in this replicon]
Location [Strand]41465..42178 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ2GI57
KEGG IDech:ECH_0044
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-50, Aligned region: 30..235
Protein Sequence: 237 a.a.     [Download]
>gi|88657917|ref|YP_506876.1| type IV secretion system protein VirB8 [Ehrlichia chaffeensis str. Arkansas]
MIRMFNKFRKKNNKNDNNKLSNANLETTYSWHVSRYNSVVIQRNMLLFFTMLALSAVGISVFVIFNISKN
RTIEPFVVEIEKKSGITTLVNPVSVKQYSADEVLNNHFIIEYVRSRELFDPNNFQYNYYTKVRLFSNQTT
YSEFRNWIRLSNPASPLNLYANVTSGYLKIRSLQHLRPGSVQIRFSLEFNHPSGIIKKDRIATLSFQYVT
LEMNEQERQINPLGFQITYYRADDEFL
 
Nucleotide Sequence: 714 bp     [Download]
>gi|88657561|ref|NC_007799.1|:c42178-41465 Ehrlichia chaffeensis str. Arkansas, complete genome
ATGATACGTATGTTTAATAAATTCAGAAAGAAGAATAATAAAAATGATAATAACAAACTATCAAACGCAA
ATTTAGAAACAACATACAGTTGGCACGTCAGTCGTTATAACTCAGTTGTTATACAAAGAAATATGCTACT
GTTTTTTACCATGCTAGCATTAAGCGCAGTAGGAATCAGCGTTTTCGTCATTTTTAATATAAGCAAAAAC
AGAACTATTGAACCATTTGTAGTAGAAATAGAGAAAAAATCTGGAATCACAACTTTAGTAAACCCTGTAT
CAGTCAAACAATACTCAGCAGACGAAGTTTTAAATAATCATTTTATAATAGAATATGTAAGATCTAGAGA
GCTTTTTGACCCTAATAATTTTCAATATAACTATTACACAAAAGTTCGTCTATTTTCTAACCAAACAACA
TACAGTGAGTTCCGTAACTGGATAAGGCTAAGTAATCCTGCAAGTCCTTTAAACTTATATGCAAATGTAA
CATCAGGATATCTTAAAATCAGATCTTTACAGCATTTGCGTCCAGGAAGTGTACAAATCAGGTTCTCCTT
AGAATTTAACCATCCAAGTGGCATAATAAAAAAAGATAGAATAGCTACATTATCATTTCAATACGTAACT
CTTGAAATGAATGAACAAGAACGGCAAATTAATCCTTTAGGATTCCAGATAACTTACTATAGGGCAGATG
ATGAATTTCTATAA
 Primer design