SecReT4
Protein ID: 88658241
T4SS name [ID]VirB [493]
Gene symbolvirB11
Locus tagECH_0041
StrainEhrlichia chaffeensis str. Arkansas
Repliconchromosome [GenBank: NC_007799] [Browse all T4SS(s) in this replicon]
Location [Strand]38281..39279 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ2GI60
KEGG IDech:ECH_0041
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.8e-89, Aligned region: 12..311
Protein Sequence: 332 a.a.     [Download]
>gi|88658241|ref|YP_506873.1| type IV secretion system protein VirB11 [Ehrlichia chaffeensis str. Arkansas]
MTTSYAALDTYLEPLQSIFHEDGVNEVSINQECEVWIENRGNIRCESIPTLNLSHLKALGRLIAQATEQK
ISEENPLLSATLPNGYRIQIVFPPACEATTVVMSIRKPSAMQLSLDDYEKMGAFNQAVTETQENNTDNQL
KELLKQKKIKQFLEHAIINKKNIIISGGTSTGKTTFTNAALRSIPQNERLITVEDAREIVLSNHPNRVHL
IASKGGQGRAKVSTQDLIEACLRLRPDRIIVGELRGSEAFSFLRAINTGHPGSISTLHADTPMMALEQLK
LMVMQAGLGIPPDQIINYITNIVDIVIQLKRGSEGKRYVSEILFTKSLQKNG
 
Nucleotide Sequence: 999 bp     [Download]
>gi|88657561|ref|NC_007799.1|:c39279-38281 Ehrlichia chaffeensis str. Arkansas, complete genome
ATGACAACAAGCTATGCCGCCTTAGATACGTATCTCGAACCACTACAATCCATCTTTCATGAAGATGGGG
TAAATGAAGTATCTATTAACCAGGAATGTGAAGTATGGATAGAAAACAGAGGAAATATACGTTGTGAATC
CATTCCGACCCTAAATTTATCGCATTTAAAAGCATTAGGCAGACTAATAGCACAAGCTACAGAACAAAAG
ATAAGCGAAGAAAATCCATTATTATCAGCAACTTTACCTAATGGCTATCGTATACAAATCGTATTTCCTC
CAGCCTGTGAAGCAACCACAGTAGTCATGTCAATTAGAAAACCATCAGCAATGCAACTTTCATTAGATGA
CTATGAAAAAATGGGCGCATTTAACCAAGCTGTAACAGAAACTCAAGAAAATAATACAGATAATCAATTA
AAAGAACTATTAAAGCAAAAAAAGATCAAGCAATTTCTAGAACATGCTATAATAAACAAAAAAAACATAA
TAATTAGTGGTGGTACATCAACAGGAAAAACAACTTTTACCAATGCAGCATTACGAAGTATACCTCAGAA
TGAAAGGCTAATAACAGTAGAAGATGCAAGAGAAATTGTTTTAAGTAATCATCCAAACAGAGTCCATTTA
ATTGCCTCAAAAGGAGGACAAGGTAGAGCTAAAGTCAGCACTCAAGATTTAATAGAGGCATGTCTAAGAT
TGCGTCCAGATAGGATAATAGTAGGAGAATTACGTGGATCTGAAGCATTTAGCTTTTTAAGAGCAATTAA
TACAGGCCATCCTGGTTCCATATCAACGTTACACGCTGACACACCAATGATGGCACTAGAACAATTAAAA
TTAATGGTTATGCAAGCAGGACTTGGCATACCTCCAGATCAAATAATTAATTACATCACTAATATAGTAG
ATATTGTAATACAGTTAAAAAGAGGATCAGAGGGTAAAAGGTATGTATCAGAAATATTATTCACTAAATC
TTTACAGAAAAATGGTTAA
 Primer design