SecReT4
Protein ID: 89255350
T4SS name [ID]VirB [219]
Gene symbol-
Locus tagRHE_PD00150
StrainRhizobium etli CFN 42
Repliconplasmid symbiotic plasmid p42d [GenBank: NC_004041] [Browse all T4SS(s) in this replicon]
Location [Strand]167756..168427 [+]
Producttransport secretion system IV, VirB8 protein
Component typeVirB8
UniProt IDQ8KIN2
KEGG IDret:RHE_PD00150
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-67, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|89255350|ref|NP_659887.2| transport secretion system IV, VirB8 protein [Rhizobium etli CFN 42]
MVTTDNLKSYFDKARRFDQDRMIQVERSARIAWFVAVCAGTLAAVSVFAIAGLTPLKTVQPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEGEENFRTVALLSTQPEQTRFAAVYRGSNPDS
PQNIYGRSATSRINIVSISLINANVASVRYMRTVTRGDEVRTTHWVATLTFSYANAPMSSTDRLTNPLGF
VVSEYRADPETIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|89255298|ref|NC_004041.2|:167756-168427 Rhizobium etli CFN 42 symbiotic plasmid p42d, complete sequence
ATGGTGACCACCGATAACCTCAAAAGTTACTTCGACAAGGCCCGCCGGTTCGATCAGGATCGGATGATCC
AGGTCGAGCGCTCTGCCCGCATCGCCTGGTTCGTCGCTGTTTGCGCCGGCACGCTTGCTGCCGTTTCCGT
CTTTGCCATTGCCGGCCTCACGCCTTTGAAAACCGTCCAGCCCTTCGTCGTGCGGGTCGACAATTCCACA
GGCATTGTTGACGTCGTCTCGGCGCTGACATCGACCGCCGGCACCTACGACGAGGCCGTCACCAAATATT
TCGCGGCCAAATATGTCCGCGCCCGCGAGGGCTACGTCTGGAGCGAGGGCGAGGAGAATTTCCGCACCGT
CGCGTTGCTATCGACGCAGCCGGAACAGACTCGATTTGCCGCAGTCTACCGCGGCAGCAATCCCGATTCC
CCGCAAAACATTTATGGCCGCAGCGCCACGTCGCGGATCAACATTGTTTCCATCTCGCTGATCAACGCCA
ATGTGGCATCCGTCCGCTATATGAGGACCGTGACCCGCGGTGACGAGGTGCGCACCACGCACTGGGTTGC
GACCCTGACCTTCTCCTATGCCAACGCTCCGATGTCCTCGACCGACCGGCTGACCAATCCGCTCGGCTTC
GTCGTCAGCGAATATCGCGCCGATCCGGAGACCATCAATTGA
 Primer design