SecReT4
Protein ID: 89885740
T4SS name [ID]Trb [770]
Gene symbol-
Locus tagRfer_4253
StrainRhodoferax ferrireducens T118
Repliconplasmid plasmid1 [GenBank: NC_007901] [Browse all T4SS(s) in this replicon]
Location [Strand]8100..8912 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ21QK5
KEGG IDrfr:Rfer_4253
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.7e-57, Aligned region: 33..251
Protein Sequence: 270 a.a.     [Download]
>gi|89885740|ref|YP_515938.1| conjugal transfer protein TrbG/VirB9/CagX [Rhodoferax ferrireducens T118]
MMRFFLKAVFSVVFVLAASWAHAQVDAEPLPGDPRLVVFQYDENNSYRVFTKPLATTHIQFDNDERVKVL
ALGDTVGWITAQKDNNVFVKPRYPNSSTSGTLITTKRTYQFVFKSTTESGRWYQRVSFQSPTDMLIEASD
ADRRHLAAAVAERPSPSTVEDRSNQSVSPELLNFNYEVTGDTRIKPLNVFDDGIATYIQIRQAEDVPAVF
RLVDKDVELVEYVLKGNTIVIPRVLEAGLLKLGNQEVRFYNLKRGSKRLFGGYSFEGSEK
 
Nucleotide Sequence: 813 bp     [Download]
>gi|89885732|ref|NC_007901.1|:c8912-8100 Rhodoferax ferrireducens T118 plasmid1, complete sequence
ATGATGAGATTTTTCCTTAAAGCCGTCTTTTCGGTTGTCTTTGTCCTTGCAGCATCCTGGGCGCACGCTC
AGGTGGATGCCGAGCCATTGCCCGGAGATCCACGACTGGTTGTCTTTCAATACGATGAAAACAACAGCTA
CCGGGTGTTCACCAAGCCGCTGGCTACAACTCACATTCAGTTCGACAACGATGAGCGGGTAAAAGTTCTT
GCGCTCGGGGACACAGTTGGCTGGATCACAGCCCAAAAAGACAATAACGTCTTTGTCAAGCCGCGTTATC
CAAATAGCAGCACGAGCGGCACGTTGATCACAACCAAACGAACCTACCAGTTCGTATTCAAGTCGACAAC
AGAGAGCGGGCGTTGGTATCAGCGGGTGTCCTTTCAGAGCCCGACTGACATGTTGATAGAGGCATCGGAT
GCTGATCGTCGCCATCTCGCTGCCGCCGTTGCTGAAAGACCGTCGCCATCAACAGTTGAGGATCGCAGCA
ATCAGTCAGTTTCACCGGAACTGCTGAACTTCAACTATGAGGTCACCGGTGACACCCGAATCAAGCCGCT
CAATGTCTTCGATGACGGCATTGCAACGTACATTCAAATTCGTCAGGCTGAAGACGTGCCAGCGGTCTTT
CGACTGGTGGACAAGGATGTCGAACTCGTTGAGTACGTTCTGAAAGGCAACACAATCGTCATACCGAGGG
TATTGGAAGCGGGCCTTCTAAAGCTTGGCAATCAGGAGGTGCGTTTCTATAACCTGAAGCGGGGCAGTAA
GCGGCTGTTCGGGGGCTATTCGTTTGAAGGTTCGGAAAAATGA
 Primer design