SecReT4
Protein ID: 89885749
T4SS name [ID]Trb [770]
Gene symbol-
Locus tagRfer_4262
StrainRhodoferax ferrireducens T118
Repliconplasmid plasmid1 [GenBank: NC_007901] [Browse all T4SS(s) in this replicon]
Location [Strand]18499..18867 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ21QJ6
KEGG IDrfr:Rfer_4262
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-19, Aligned region: 14..110
Protein Sequence: 122 a.a.     [Download]
>gi|89885749|ref|YP_515947.1| conjugal transfer protein TrbC [Rhodoferax ferrireducens T118]
MHSLAISHGNVSDDKLKLRLMLAMLFVFLVLTLLPDLAHAQSGPLPWETFSNKLACTLSGNWVKWMAVIA
IALGGVMFGLGELSGPFQKMMQIAGGFSIALGAVGIVNMLLNTSGTNINLCP
 
Nucleotide Sequence: 369 bp     [Download]
>gi|89885732|ref|NC_007901.1|:c18867-18499 Rhodoferax ferrireducens T118 plasmid1, complete sequence
ATGCATTCTCTCGCAATATCCCACGGCAACGTGTCAGACGACAAGTTGAAACTCCGACTCATGTTGGCCA
TGTTGTTTGTCTTTTTGGTATTGACGCTTTTGCCCGATCTTGCGCACGCGCAGAGTGGGCCTCTGCCTTG
GGAAACGTTTAGCAATAAATTGGCGTGTACATTGTCTGGAAACTGGGTGAAGTGGATGGCAGTGATTGCA
ATTGCGTTGGGTGGAGTCATGTTCGGTCTTGGCGAATTGTCGGGGCCATTTCAGAAGATGATGCAGATTG
CAGGAGGCTTCAGTATCGCGCTGGGAGCTGTCGGGATTGTGAATATGTTGCTTAATACCTCAGGCACCAA
CATAAACCTTTGCCCGTGA
 Primer design