SecReT4
Protein ID: 90425021
T4SS name [ID]Trb [301]
Gene symbol-
Locus tagRPC_3533
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]3926570..3927610 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ210W4
KEGG IDrpc:RPC_3533
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.4e-68, Aligned region: 119..341
Protein Sequence: 346 a.a.     [Download]
>gi|90425021|ref|YP_533391.1| conjugal transfer protein TrbG/VirB9/CagX [Rhodopseudomonas palustris BisB18]
MKSCFLNNMMPAPHPLARTSSVRAASALLLMSASMLAGCSHLQKPPEIALDDPAEPAVLLGDPPAPVQVV
ELAKPLPLPGQLKPLGRGKPTPEAKDPAVRVNQANAAARVQPVRNGFINAVQVYPFTSGALYQVYTAPGQ
ITDVMLQAGEQLTGSGPVAAGDTVRWIIGDTESETGAAKKVHILIKPTRPDLVTNLVINTDRRTYFLELR
STEKTYMASVSWQYPEDQLIALRRHNAAALTAAPIDEGIEVSKLRFRYAITGDNPPWRPMSAFDDGSKVY
IEMPRGIGQGEAPPLFVIGPEGDGQLVNYRVRQNYYIVDRLFGAAELRLGGDQQQTVRISRTDGRL
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c3927610-3926570 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGAAATCGTGTTTCCTGAACAACATGATGCCCGCTCCGCACCCGCTCGCCCGGACGTCGTCAGTGAGGG
CCGCTTCGGCGTTGCTGCTGATGTCCGCTTCGATGCTCGCCGGCTGCTCGCATCTGCAAAAGCCGCCGGA
AATCGCGCTCGATGATCCGGCAGAACCCGCCGTGCTGCTCGGCGATCCGCCAGCACCGGTGCAGGTGGTA
GAACTCGCCAAGCCGCTGCCGCTACCCGGTCAGTTGAAGCCATTGGGGCGCGGCAAACCCACGCCCGAGG
CGAAGGACCCGGCCGTGCGCGTCAATCAGGCCAATGCCGCCGCACGGGTCCAGCCGGTACGCAACGGCTT
TATCAACGCCGTGCAGGTCTATCCATTCACCAGCGGCGCGCTCTATCAGGTCTACACCGCGCCTGGCCAA
ATCACCGACGTGATGCTCCAGGCCGGCGAGCAGCTGACCGGCTCCGGGCCCGTCGCTGCCGGCGACACCG
TGCGCTGGATCATCGGCGACACCGAGAGCGAAACCGGCGCCGCCAAAAAGGTTCACATCCTGATCAAGCC
GACGCGCCCCGATCTCGTCACCAACCTCGTCATCAACACCGATCGGCGGACCTATTTCCTTGAACTGCGT
TCGACCGAAAAGACCTACATGGCCTCGGTCTCCTGGCAGTACCCTGAAGATCAGCTCATTGCGCTGCGGC
GCCACAACGCGGCCGCGTTGACCGCGGCGCCGATCGACGAGGGCATCGAGGTTTCCAAACTGCGCTTCCG
CTATGCCATCACCGGCGACAATCCGCCCTGGCGGCCAATGTCCGCCTTCGACGACGGCTCAAAAGTCTAT
ATCGAGATGCCACGCGGGATCGGGCAGGGTGAAGCGCCGCCGCTGTTCGTAATCGGACCTGAAGGCGACG
GCCAACTCGTCAATTATCGCGTCCGGCAAAACTATTATATCGTCGACCGGCTGTTCGGTGCCGCCGAGTT
GCGCCTTGGTGGCGACCAGCAGCAGACGGTCCGTATCTCCCGCACCGACGGGAGGCTTTGA
 Primer design