SecReT4
Protein ID: 90425023
T4SS name [ID]Trb [301]
Gene symbol-
Locus tagRPC_3535
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]3928294..3929589 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ210W2
KEGG IDrpc:RPC_3535
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.2e-51, Aligned region: 37..261
Protein Sequence: 431 a.a.     [Download]
>gi|90425023|ref|YP_533393.1| conjugal transfer protein TrbL [Rhodopseudomonas palustris BisB18]
MGGTGVIDRFLAVFTQYIDSGFGLLQPEVAFVATTLIAIDITLAALFWSWGGDNDIIARLVKKTLFVGVF
AYLIGNWNKLARIIFESFSGLGLKAAGSGLSAADFLRPGRVAQVGLDAGRPLLEQISSLMGYIAIFENFI
QITVLLLAWVMVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIVGIGSTLFSQFTVAAATPPSIDDAMAMVLAALSLLGLGIFGPGIANGLVSGGPQLGAGSAVGAAAAG
GGVVAAGLAGTAMAGSGLAAASGIAAGAARGGAALAGGATTAFRAGGASGLATTGLTKGAEAAISPLRRA
AENLKSSFEAGGRAAAGEGSSADAGGAASSSAASSAGEPPAWARRMKRAQTINHGTSAAAHAVRSGDHGG
GGASVNLSEGE
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c3929589-3928294 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGATCGATTTCTCGCGGTCTTCACCCAATATATCGATAGCGGCTTCGGGC
TGCTGCAGCCCGAGGTGGCCTTTGTCGCCACCACGTTGATCGCCATCGATATCACGCTGGCGGCGCTGTT
CTGGAGCTGGGGCGGCGATAACGACATCATCGCGCGGCTGGTGAAGAAGACGCTGTTCGTCGGCGTCTTC
GCCTATCTGATCGGCAACTGGAATAAGCTTGCCCGGATCATCTTCGAGAGCTTCTCTGGTCTCGGCCTGA
AAGCCGCCGGCTCTGGACTTTCAGCCGCCGACTTTCTGCGCCCGGGCCGTGTCGCCCAGGTCGGGCTCGA
TGCCGGACGGCCGCTGCTGGAGCAGATCTCCAGCCTGATGGGCTACATCGCCATCTTCGAGAATTTCATC
CAGATCACGGTTTTGCTGCTGGCGTGGGTGATGGTGCTGCTGGCATTTTTCATCCTGGCGATCCAGCTGT
TCGTCACCCTGATCGAATTCAAGCTGACGACGCTGGCGGGCTTCGTGCTGATTCCCTTCGGCCTGTTCGG
CAAGTCCGCCTTCATGGCCGAGCGCGTGCTCGGCAACGTCATCTCGTCTGGCATCAAGGTGCTGGTACTC
GCCGTCATCGTCGGCATCGGCTCGACGCTGTTTTCACAGTTCACGGTGGCCGCAGCCACCCCGCCATCGA
TCGACGACGCCATGGCGATGGTGCTCGCCGCGCTCTCGCTGCTTGGCCTCGGAATTTTCGGTCCCGGCAT
TGCCAATGGCCTCGTCTCCGGTGGTCCGCAGCTTGGCGCTGGCTCCGCTGTCGGCGCGGCCGCAGCGGGT
GGGGGCGTTGTTGCGGCCGGACTTGCTGGCACCGCCATGGCAGGCAGCGGACTGGCCGCGGCTAGTGGCA
TTGCGGCCGGCGCCGCGCGCGGCGGTGCAGCACTGGCCGGCGGCGCCACGACAGCGTTTCGTGCGGGAGG
GGCGTCGGGATTGGCAACGACTGGGCTCACCAAGGGGGCCGAGGCCGCGATCAGCCCACTACGCCGCGCT
GCCGAAAACCTCAAGAGCAGCTTCGAGGCCGGAGGCCGAGCGGCGGCAGGTGAGGGGAGTTCGGCAGACG
CCGGCGGAGCCGCATCATCCTCTGCGGCTTCATCCGCCGGCGAACCGCCGGCCTGGGCGCGCCGCATGAA
GCGCGCGCAAACCATCAACCACGGGACGTCCGCTGCCGCACACGCTGTTCGCTCCGGCGATCACGGCGGC
GGCGGAGCCTCTGTCAATCTCTCCGAGGGGGAATAG
 Primer design