SecReT4
Protein ID: 90425028
T4SS name [ID]Trb [301]
Gene symbol-
Locus tagRPC_3540
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]3933424..3933768 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ210V7
KEGG IDrpc:RPC_3540
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-23, Aligned region: 18..104
Protein Sequence: 114 a.a.     [Download]
>gi|90425028|ref|YP_533398.1| conjugal transfer protein TrbC [Rhodopseudomonas palustris BisB18]
MIHRPHPLRRAIATPAGFTTLTTVLASLTAAPAWAAGSSMPWEQPLNQILQSVEGPVAKIMAVIIIIVTG
LTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 345 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c3933768-3933424 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGATCCATCGTCCGCACCCACTTCGCCGCGCCATCGCCACGCCCGCCGGCTTTACAACCCTGACCACGG
TCCTGGCTTCGTTGACCGCTGCACCGGCTTGGGCGGCCGGCTCCAGCATGCCGTGGGAGCAACCGCTCAA
CCAGATCCTGCAATCGGTCGAAGGCCCGGTCGCCAAGATCATGGCGGTGATCATCATCATCGTCACCGGC
CTGACATTGGCGTTCGGCGATACCTCGGGTGGATTTCGCCGACTGATCCAGATCGTGTTCGGTCTCTCGA
TTGCGTTCGCGGCAAGCTCCTTCTTCCTCTCGTTCTTCTCCTTCGGCGGCGGAGCGCTGGTCTGA
 Primer design