SecReT4
Protein ID: 90425367
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3892
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4322733..4323935 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ20ZL8
KEGG IDrpc:RPC_3892
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.9e-66, Aligned region: 212..395
Protein Sequence: 400 a.a.     [Download]
>gi|90425367|ref|YP_533737.1| conjugation TrbI-like protein [Rhodopseudomonas palustris BisB18]
MSGGADDARVEPEPVASMRLRAERPRVTRLSRKVLAGGAAVGTFAIFGAVLWALQNNRSRTTQSSELYTT
EHRQVADGLTGLPRDYAGVPRQAPPLGPALPGDLGRPILRAQNAPSTLIPGADQEQQRESQEIEAARLSR
LFASTNIRDLPMPALQTVATDSSATTTSQSAHPAADDAFAQNGQDRKLAFVNGPIDRRTTSPDRVAAPAS
TYVVQAGNVIPASLITGIRSDLPGQITAQVTENIFDSPTGRWLLVPQGARLIGIYDSQIAFGQSRVLLVW
TRLIMPNGRSIVLERQPGADTAGYAGLEDGVDQHWGALFKAALLSTLLGVGTELGSSTATSGNNADIIQA
LRRGSSDSLNQTGQQVVRRNLNIQPTLTIRPGFPVRVIVNRDLVLEPYKG
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4323935-4322733 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGAGCGGAGGAGCCGACGACGCTCGCGTTGAACCCGAACCGGTCGCATCGATGCGATTGCGGGCAGAGC
GCCCACGTGTGACGCGATTGTCACGCAAGGTGCTGGCAGGAGGTGCGGCCGTTGGGACATTTGCGATCTT
CGGTGCGGTGCTATGGGCGCTGCAGAACAATCGGTCGCGCACCACACAATCAAGCGAACTCTACACAACC
GAGCATCGCCAGGTCGCCGATGGTCTGACGGGATTGCCGCGCGACTATGCCGGGGTGCCGCGGCAGGCGC
CTCCACTTGGACCGGCGTTACCGGGCGATCTCGGCCGGCCGATCCTGCGCGCGCAAAATGCGCCGTCGAC
ACTCATACCCGGCGCCGATCAAGAGCAGCAGCGCGAGAGCCAGGAGATCGAAGCAGCGCGGCTCAGCCGG
CTGTTTGCTTCGACCAATATTCGGGACTTGCCGATGCCGGCGCTGCAAACAGTTGCGACTGATTCATCAG
CGACAACCACGAGCCAGTCTGCTCACCCCGCGGCCGACGACGCCTTTGCTCAGAATGGCCAGGACCGCAA
GCTCGCCTTCGTCAATGGCCCGATCGATCGCCGAACCACAAGCCCCGACCGGGTCGCGGCGCCTGCGTCA
ACCTATGTGGTGCAGGCTGGCAACGTCATCCCGGCGTCGCTCATCACTGGGATCCGCTCGGATCTTCCTG
GGCAAATCACCGCTCAGGTTACCGAGAACATTTTTGACAGTCCAACCGGGCGTTGGCTGCTCGTTCCGCA
GGGAGCCCGGCTAATAGGGATTTATGACAGCCAAATTGCGTTCGGTCAGTCCCGGGTGCTGTTGGTCTGG
ACCCGCCTGATCATGCCGAATGGTCGATCAATTGTATTGGAACGACAGCCTGGCGCCGACACTGCCGGTT
ATGCAGGGCTTGAGGATGGGGTCGATCAACATTGGGGTGCATTGTTCAAGGCGGCGCTGCTTTCGACCTT
GCTCGGCGTCGGAACGGAACTCGGATCAAGCACGGCCACGAGCGGCAACAACGCAGACATCATCCAGGCC
CTTCGACGCGGGTCGAGCGACAGTCTGAATCAGACCGGTCAGCAAGTGGTTCGACGCAATCTCAATATTC
AGCCGACATTGACAATCCGACCGGGATTTCCGGTGCGCGTGATCGTCAATCGGGACCTCGTGCTCGAACC
CTACAAAGGTTAG
 Primer design