SecReT4
Protein ID: 90425368
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3893
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4323932..4324936 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ20ZL7
KEGG IDrpc:RPC_3893
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-67, Aligned region: 106..328
Protein Sequence: 334 a.a.     [Download]
>gi|90425368|ref|YP_533738.1| conjugal transfer protein TrbG/VirB9/CagX [Rhodopseudomonas palustris BisB18]
MMKSLLLRHAAWPVLLLSVSMVAGCTIPLKPPPDISYDIEAQPAVQMLDPPKPVEIVELPTPLPLPGQLK
PLKGARSKPESPDPRQRVEKANAAARVQPTRHGYINAVQVYPFSSGALYQVYAAPGQVTDVALQEGEQLV
GSGPVAAGDTVRWIIGDTESGAGPTKRIHILMKPTRPDLVSNLVINTDRRTYLLELRSAEKTYMASVSWQ
YPQDQLIALRRQNASAEAATPIVTGVDISRLRFRYAIEGDNPPWRPLSAFDDGSKVYIEMPSGIAQGEAP
PLFVIGPEGEGQLVNYRVRQNYYIVDRLFAAAELRMGGEHQQSVRISRTDGRGR
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4324936-4323932 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGATGAAGTCACTGTTGTTGCGTCACGCTGCCTGGCCAGTCCTGCTACTGTCGGTTTCGATGGTTGCTG
GCTGCACCATCCCGCTGAAGCCTCCGCCGGACATCTCCTATGACATCGAGGCACAGCCCGCCGTCCAGAT
GCTGGATCCACCGAAACCGGTCGAGATCGTGGAATTGCCGACGCCCTTGCCGCTGCCGGGTCAGTTGAAG
CCGCTGAAGGGCGCGCGTTCAAAGCCTGAGTCGCCCGACCCTCGTCAACGTGTCGAGAAGGCCAATGCCG
CTGCGCGCGTTCAGCCCACTCGCCACGGCTACATCAATGCGGTGCAGGTCTATCCGTTCTCGTCCGGGGC
GCTGTATCAGGTCTATGCCGCGCCGGGTCAGGTGACCGATGTTGCTCTGCAGGAAGGCGAGCAACTCGTT
GGCTCCGGGCCGGTCGCCGCCGGCGACACCGTGCGCTGGATCATTGGCGACACTGAAAGCGGGGCAGGAC
CGACCAAGCGGATTCATATCCTGATGAAGCCTACCAGACCCGACCTCGTCTCCAATCTGGTCATCAACAC
CGATCGCCGCACTTATTTGCTTGAGCTGCGTTCCGCCGAGAAGACCTATATGGCCTCGGTGTCCTGGCAA
TACCCACAGGATCAGCTGATTGCGCTGCGTCGGCAGAATGCGAGCGCGGAAGCCGCGACCCCGATCGTGA
CCGGCGTCGACATATCGCGGCTGCGTTTCCGCTACGCAATCGAGGGTGACAACCCACCCTGGCGTCCGCT
CTCCGCCTTCGATGACGGCTCCAAGGTCTACATCGAGATGCCTAGCGGGATAGCCCAGGGCGAGGCGCCG
CCGCTGTTCGTGATTGGCCCCGAAGGCGAGGGGCAACTAGTGAACTATCGCGTCCGGCAGAACTATTACA
TCGTCGATCGCCTGTTCGCCGCGGCGGAACTGCGCATGGGCGGCGAGCATCAGCAGAGCGTCCGGATCAG
CCGCACCGACGGGAGAGGGCGATGA
 Primer design