SecReT4
Protein ID: 90425369
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3894
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4324933..4325613 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ20ZL6
KEGG IDrpc:RPC_3894
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-57, Aligned region: 21..224
Protein Sequence: 226 a.a.     [Download]
>gi|90425369|ref|YP_533739.1| conjugal transfer protein TrbF [Rhodopseudomonas palustris BisB18]
MFKRSSVHYGRTPKPETPYQKAAQVWDERIGSARVQAKNWRLMAFGCLLLSGGLASGLVWQSVRGTVTPW
VVEVDRLGQAQAVAPADSRFQPTDPQIAFHLARFIEEVRGLPADGIVLRQNWLRAYDFTTDRGAAALNDF
ARTNDPFANLGKLQISIEVSSVIRASPTSFRVAWIQRAYENGSLSVTERWTAIVTVVIDAPRDADRVRKN
PLGIYVNAINWSKELG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4325613-4324933 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGTTCAAGAGATCTTCCGTACACTACGGCCGCACGCCCAAACCCGAAACGCCGTATCAGAAGGCTGCGC
AAGTCTGGGACGAGCGGATCGGCTCGGCACGGGTCCAGGCCAAAAACTGGCGCCTGATGGCGTTCGGCTG
CCTGCTGCTATCCGGCGGGCTTGCCTCCGGTTTGGTCTGGCAATCGGTCCGCGGCACCGTCACGCCGTGG
GTGGTGGAGGTCGATCGTCTCGGTCAGGCCCAGGCCGTGGCGCCTGCGGACAGCCGGTTTCAGCCGACCG
ATCCGCAGATCGCATTCCACCTCGCGCGCTTCATTGAGGAAGTTCGCGGTCTTCCCGCCGACGGCATTGT
GCTGCGGCAGAACTGGCTTCGCGCCTACGACTTCACCACCGATCGGGGTGCTGCGGCGCTGAACGATTTT
GCCCGCACCAACGATCCCTTCGCCAACCTCGGAAAGCTTCAGATCTCGATCGAAGTTTCCAGTGTGATCC
GTGCCTCGCCGACCTCGTTCCGCGTCGCCTGGATCCAGCGCGCCTATGAGAACGGCAGCCTGAGCGTCAC
CGAGCGCTGGACCGCGATCGTCACCGTCGTGATCGACGCGCCGCGAGATGCGGATCGTGTGCGCAAGAAT
CCACTTGGGATCTACGTCAACGCCATCAACTGGTCGAAGGAGCTTGGATGA
 Primer design