SecReT4
Protein ID: 90425370
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3895
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4325613..4326785 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ20ZL5
KEGG IDrpc:RPC_3895
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-51, Aligned region: 38..262
Protein Sequence: 390 a.a.     [Download]
>gi|90425370|ref|YP_533740.1| conjugal transfer protein TrbL [Rhodopseudomonas palustris BisB18]
MGGTGVIDRFLEVFTRFIDSGFGLLNGEVAFLATTLAAIDITLAAIFWSWAADEDIIARLAKKTLFVGVF
AYLIGNWNSLARIVFESLAGLGLKASGTGMSMADLLRPGRVAQVGIDAGRPILDSISGLLGYISFFENFV
QIVVLLFAWIVVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFAAERVLGNVISSGIKVLVL
AVIVGIGTTLFSQFTAGFGGNQPTIEDALTLVLAALSLLGLGIFGPGIANGIVSGGPQLGAGAAVGTGLA
AGGIVAAGAAGATMAAGAAGGVLAGGARGAATLMQAGGSTIASPLRRSAADQSGQGAASPGSPSGGEPAW
ATRMKRSQTVGHGASAAVHAVRSGDHGGGGASVDVSEGKS
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4326785-4325613 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGGGGGGCACCGGGGTTATCGATCGCTTTCTCGAGGTCTTTACCCGTTTCATTGATTCGGGCTTTGGCT
TGCTCAATGGCGAAGTGGCGTTTCTGGCCACCACGCTGGCCGCAATCGACATCACGCTCGCGGCGATCTT
CTGGAGCTGGGCAGCCGACGAGGACATCATTGCCCGGCTCGCAAAGAAGACGCTGTTCGTCGGCGTGTTC
GCCTACCTGATCGGCAATTGGAATAGCCTCGCCCGCATTGTTTTCGAGAGTCTTGCAGGACTAGGACTGA
AGGCGTCCGGCACCGGGATGTCGATGGCCGATCTGCTCAGGCCCGGCCGGGTCGCCCAGGTCGGCATCGA
TGCCGGACGACCGATCCTGGACTCGATCTCGGGTCTGTTGGGCTACATCAGCTTCTTTGAGAATTTTGTT
CAGATTGTCGTGTTGCTGTTCGCCTGGATCGTGGTGCTGCTCGCCTTCTTCATCCTGGCGATCCAGCTGT
TCGTGACCCTGATCGAGTTCAAGCTGACGACGCTCGCGGGTTTCGTGCTGATCCCATTCGGCCTGTTCGG
CAAGACCGCATTTGCCGCCGAACGCGTGCTTGGCAACGTCATCTCATCCGGCATCAAGGTGCTGGTTCTC
GCCGTCATTGTCGGCATCGGCACCACGCTGTTCTCGCAATTCACCGCTGGATTCGGCGGCAACCAGCCGA
CCATCGAGGATGCTCTGACGCTGGTGCTCGCCGCATTGTCGTTGCTGGGCCTCGGCATTTTTGGTCCGGG
GATCGCCAACGGCATTGTGTCGGGAGGTCCGCAGCTCGGCGCAGGTGCGGCGGTTGGGACCGGTCTTGCG
GCGGGCGGCATCGTCGCTGCCGGTGCGGCTGGGGCGACGATGGCTGCCGGGGCCGCTGGCGGCGTTCTTG
CCGGCGGTGCGCGTGGTGCCGCCACTTTGATGCAGGCGGGTGGCTCAACCATCGCCAGCCCGCTGCGCCG
AAGCGCAGCCGATCAATCAGGGCAGGGAGCAGCGTCGCCAGGTTCGCCGTCTGGCGGTGAACCGGCGTGG
GCCACCCGCATGAAGCGCTCGCAAACCGTCGGCCACGGGGCTTCCGCCGCGGTCCATGCGGTCCGTTCCG
GTGATCATGGCGGCGGCGGCGCGTCGGTCGATGTTTCCGAGGGGAAAAGCTGA
 Primer design