SecReT4
Protein ID: 90425372
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3897
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4327147..4327884 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ20ZL3
KEGG IDrpc:RPC_3897
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|90425372|ref|YP_533742.1| conjugal transfer protein TrbJ [Rhodopseudomonas palustris BisB18]
MIRIRNLVTASAIALTIATVPVPSRAQVVVFDPNNYVQNVLTAARALQQINNQITSLQNQAQMLINQARN
LASLPYSSLQQLQSSIQRTQQLLVQAQRIAYDVQQIDRAFTTTYAPASAGTSSQALIGNAQQRWQTSLAA
LQDALRVQAGVVGNLDTHRSEMSALVTSSQSATGALQAAQAGNQLIALQGQQLADLTATVAAQGRAASLD
AAQRSAAQDQGREQLRRFLTPGAGYQPSNVQMFHQ
 
Nucleotide Sequence: 738 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4327884-4327147 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGATCAGAATCCGTAACCTCGTCACGGCGAGCGCCATAGCTCTGACCATTGCGACCGTACCAGTGCCAT
CCCGGGCGCAGGTAGTGGTGTTCGATCCAAACAACTACGTCCAGAATGTGCTGACGGCGGCGCGCGCGCT
GCAACAGATCAACAACCAGATCACCTCGCTGCAGAATCAGGCGCAGATGTTGATCAATCAGGCGAGGAAT
CTGGCCAGCCTGCCATATTCGTCGTTGCAGCAACTGCAATCGTCGATCCAGCGCACTCAACAGCTTCTCG
TGCAGGCGCAACGCATCGCCTACGACGTCCAGCAGATCGACCGGGCGTTTACGACTACCTACGCGCCGGC
ATCGGCCGGCACATCAAGCCAGGCGCTGATCGGCAATGCGCAGCAGCGCTGGCAGACCTCTCTCGCAGCC
TTGCAGGATGCGCTGCGGGTCCAGGCCGGCGTCGTCGGCAATCTCGATACCCATCGCAGCGAGATGTCGG
CGCTGGTGACGTCGAGCCAGTCCGCGACCGGAGCGCTGCAGGCGGCCCAGGCCGGCAACCAGCTGATCGC
GTTGCAGGGCCAGCAACTCGCGGATCTGACCGCGACCGTCGCAGCTCAAGGACGGGCCGCGAGCCTGGAT
GCCGCCCAACGCAGCGCCGCGCAGGACCAGGGTAGGGAGCAGCTCCGCCGCTTCCTGACCCCTGGCGCCG
GCTACCAGCCCAGCAACGTTCAGATGTTCCACCAATGA
 Primer design