SecReT4
Protein ID: 90425373
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3898
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4327881..4330322 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ20ZL2
KEGG IDrpc:RPC_3898
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6.1e-35, Aligned region: 443..724
CagE_TrbE_VirB [PF03135], Evalue: 6.6e-12, Aligned region: 183..389
Protein Sequence: 813 a.a.     [Download]
>gi|90425373|ref|YP_533743.1| conjugal transfer ATPase TrbE [Rhodopseudomonas palustris BisB18]
MMNLSEYRHSTTCLADFLPWAALVGQGVVLNKDGSFQRTATFRGPDLDSAVPAELVGITARLNNALRRLG
SGWAVFVEAQRHPASKYPECHFPDAASALVDLERRAQFEEEGAHFESSYFLTFLYLPPAADVARAERLLY
EGRDRDEGTDAREILGGFVDRTDRVLQLVEGFMPESAWLDDQDTLTYLHSTISTKRYRIRVPETPMYLDA
LLADQPLTGGLEPMLGNAHLRVLTIVGFPTTTTPGILDELNALAFAYRWSTRAIMLDKTDATKLLTKIRR
QWFAKRKSIAAILKEVMTNEAATLVDTDAQNKAMDADAALQELGSDAIGQAFVTATVAVWDGDPRAADEK
LRLVEKVIQGRDFTCMAESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPLRDDHFDAP
PLFFARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGGSIRAAALAM
GGDWHDLGGALSDNATEPVALQPLALIDDAAERGWAAEWIGNILARETIRITPEAKEHLWSALSSLASAP
APERTLTGLSVLLQSQTLKRALQSYCLGGPYGRLLDAEAERLGEGAVQAFETEGLIGTSAAPAVLGYLFH
RIERRLDGRPTLLIIDEGWLALDDEGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPT
RLFLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGGVALALAAASSKAD
HTLIESVIAEHGRDGFLAAWLTQRGAGWAVDFIPRLSTKEPSA
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4330322-4327881 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGATGAATCTTTCGGAGTATCGGCACTCGACGACATGCCTCGCCGACTTTCTGCCCTGGGCCGCGTTGG
TCGGTCAGGGCGTGGTGTTGAACAAGGACGGATCTTTCCAGCGAACCGCAACGTTTCGCGGGCCGGACCT
GGATTCCGCCGTGCCGGCCGAACTGGTCGGTATTACGGCACGCTTGAACAATGCCTTGCGCCGGCTGGGG
TCGGGATGGGCCGTGTTCGTCGAGGCGCAGCGCCATCCCGCGAGCAAATATCCCGAGTGCCATTTTCCGG
ATGCTGCATCGGCTTTAGTTGATCTCGAGCGCCGCGCTCAGTTCGAGGAGGAGGGCGCGCACTTCGAATC
CAGCTACTTCCTGACTTTCCTCTATCTGCCGCCGGCCGCCGATGTCGCGCGCGCCGAGCGCTTGCTGTAC
GAGGGGCGCGATCGCGACGAAGGCACCGATGCACGCGAGATATTGGGCGGTTTCGTCGATCGCACCGACC
GGGTGCTTCAACTGGTCGAGGGTTTTATGCCCGAGAGCGCTTGGCTCGATGACCAGGACACCCTGACCTA
TCTGCATTCCACGATCTCGACCAAGCGCTACCGGATCAGGGTTCCGGAAACGCCGATGTATCTCGATGCA
CTGCTGGCCGACCAGCCGCTGACCGGTGGGTTGGAGCCGATGCTCGGCAATGCGCATCTGCGGGTGCTGA
CCATCGTGGGTTTCCCGACCACCACCACTCCCGGCATCCTCGACGAATTGAATGCACTGGCCTTCGCCTA
TCGCTGGTCGACCCGCGCCATCATGCTCGACAAGACCGACGCCACAAAGCTGTTGACGAAGATTCGGCGG
CAGTGGTTCGCCAAGCGCAAATCGATTGCGGCCATCCTCAAGGAGGTGATGACCAACGAGGCCGCGACCC
TGGTCGATACCGACGCCCAGAACAAGGCGATGGATGCGGACGCGGCGTTGCAGGAACTCGGGTCCGACGC
GATCGGGCAGGCCTTTGTCACAGCAACGGTCGCGGTATGGGACGGCGACCCGCGTGCCGCTGACGAAAAG
CTCCGCCTTGTAGAGAAAGTAATTCAAGGCCGCGACTTCACCTGCATGGCTGAGAGCGTCAACGCCGTCG
AAGCCTGGCTCGGATCGCTGCCAGGTCACGCCTACGCCAATGTTCGCCAGCCGCCGGTTTCGACGCTGAA
TCTGGCCCACATGATTCCGCTCTCGGCGGTATGGGCCGGACCGCTCCGAGACGATCATTTTGATGCTCCG
CCGCTGTTCTTTGCCCGCACCGAGGGCGCGACCCCGTTCCGGTTTTCGCTGCACGTTGGCGATGTTGGGC
ATACGCTGGTCGTCGGTCCGACCGGCGCCGGCAAGAGTGTGCTGCTGGCGCTGATGGCGCTGCAGTTCCG
GCGTTACGCCGGTTCACAGGTGTTCGCTTTCGATTTCGGCGGCTCGATCCGGGCCGCCGCGCTCGCGATG
GGCGGCGATTGGCACGATCTCGGTGGCGCGCTCTCCGACAATGCGACCGAACCGGTCGCGCTGCAGCCGC
TGGCTCTGATCGATGACGCCGCGGAGCGCGGATGGGCGGCGGAATGGATCGGCAACATTTTGGCGCGTGA
GACCATCCGGATCACCCCGGAAGCGAAAGAGCATCTGTGGTCGGCGCTGTCGTCGCTGGCGTCTGCGCCG
GCACCGGAGCGCACGCTGACCGGCCTGTCAGTGCTGCTGCAGTCGCAGACTCTGAAGCGCGCGCTGCAAT
CCTATTGCCTCGGCGGTCCCTACGGCCGGCTGCTCGATGCCGAGGCTGAACGGCTGGGTGAGGGCGCAGT
CCAGGCCTTCGAGACCGAGGGGCTGATCGGCACCAGCGCCGCGCCCGCGGTGCTCGGCTATCTGTTTCAT
CGCATTGAGCGGCGGCTCGATGGCCGGCCGACCTTGTTGATCATCGACGAAGGCTGGCTCGCGCTTGATG
ACGAGGGCTTTGCCGGCCAGCTTCGCGAGTGGCTAAAGACGCTGCGCAAGAAGAACGCTTCGGTAATCTT
CGCCACCCAATCACTATCGGACATCGATGGCTCGGCGATCGCACCGGCCATCATCGAGAGCTGTCCGACA
AGGTTGTTCCTGCCCAACGAGCGCGCGATCGAACCGCAGATCACCGCGATCTATCGCCGCTTCGGCCTGA
ACGACCGCCAGATCGAGATCCTGGCCCGGGCCACGCCAAAGCGCGATTACTACTGCCAGTCGCGGCGCGG
CAACCGGCTGTTCGAGCTTGGCCTCGGCGGTGTCGCGCTGGCTTTGGCGGCCGCGTCCTCGAAGGCCGAT
CATACCTTGATCGAGAGCGTCATCGCCGAACATGGCCGTGACGGCTTCCTCGCCGCCTGGCTGACCCAGC
GCGGCGCCGGCTGGGCGGTCGATTTCATCCCAAGGCTTTCCACAAAGGAGCCGTCAGCATGA
 Primer design