SecReT4
Protein ID: 90425374
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3899
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4330347..4330628 [-]
Producttype IV secretory pathway, VirB3-like
Component typeTrbD
UniProt IDQ20ZL1
KEGG IDrpc:RPC_3899
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.2e-11, Aligned region: 11..85
Protein Sequence: 93 a.a.     [Download]
>gi|90425374|ref|YP_533744.1| type IV secretory pathway, VirB3-like [Rhodopseudomonas palustris BisB18]
MDASATAEQPIPGFTVPVHRALTEPILLGGAPRAVAILNGTLAAALGLGLRLWLAGLVLWVIGHGAAVWA
TKRDPQFVDVVRRHLRISGHLSV
 
Nucleotide Sequence: 282 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4330628-4330347 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGGACGCTTCCGCCACTGCAGAACAGCCGATCCCGGGCTTTACCGTGCCGGTGCATCGCGCGCTCACCG
AACCGATCCTGCTCGGCGGCGCGCCGCGCGCGGTTGCCATCCTCAACGGCACGCTGGCCGCCGCACTCGG
CCTCGGCCTGCGTCTGTGGCTCGCTGGTCTCGTCCTATGGGTCATCGGCCATGGCGCCGCGGTGTGGGCA
ACCAAGCGGGATCCTCAATTCGTCGATGTGGTGCGCAGGCATCTGCGGATCTCCGGACATCTGAGCGTCT
GA
 Primer design