SecReT4
Protein ID: 90425375
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3900
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4330628..4330957 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ20ZL0
KEGG IDrpc:RPC_3900
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-23, Aligned region: 7..99
Protein Sequence: 109 a.a.     [Download]
>gi|90425375|ref|YP_533745.1| conjugal transfer protein TrbC [Rhodopseudomonas palustris BisB18]
MNPSLQHIRRHAVTAVTTAPFALISGSVWAAGSNMPWEQPLSQILQSVEGPVAKILAVIIIIVTGLTLAF
GDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGVVV
 
Nucleotide Sequence: 330 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4330957-4330628 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGAATCCGTCGCTTCAGCATATTCGTCGCCACGCCGTCACCGCAGTCACTACCGCCCCTTTTGCGCTCA
TCTCAGGTTCGGTTTGGGCTGCCGGCTCGAACATGCCTTGGGAACAGCCGCTCAGTCAGATCCTGCAATC
GGTGGAAGGGCCGGTCGCCAAAATCCTCGCGGTGATCATCATCATCGTCACTGGCTTGACGCTGGCGTTC
GGCGATACCTCGGGTGGTTTCCGCAGGCTGATCCAGATCGTGTTCGGCCTGTCGATCGCGTTCGCGGCGA
GCTCCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGCGGCGTGGTGGTGTGA
 Primer design