SecReT4
Protein ID: 90425376
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3901
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4330954..4331922 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ20ZK9
KEGG IDrpc:RPC_3901
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-86, Aligned region: 27..290
DEAD [PF00270], Evalue: 1.9e-05, Aligned region: 135..198
TrwB_AAD_bind [PF10412], Evalue: 5e-05, Aligned region: 147..183
Zeta_toxin [PF06414], Evalue: 6.8e-05, Aligned region: 145..214
FtsK_SpoIIIE [PF01580], Evalue: 7.6e-05, Aligned region: 142..177
Protein Sequence: 322 a.a.     [Download]
>gi|90425376|ref|YP_533746.1| type II secretion system protein E [Rhodopseudomonas palustris BisB18]
MAIHHLNHEATSRGARMLRTALGPSIALWLEDAEVVEVMLNPDGRLWIDRLAVGLVDTGERLSARDGERI
VRLVAHHVGVEVHSASPRVSAELPETGERFEGLLPPVVAAPTFAIRKPAVAVFTLDDYAAAGIMTACQAE
TLRAAVAERRNILVAGGTSTGKTTLTNALLAEVAKTSDRVVLIEDTRELQCQAPNFVALRTKDGVASLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGTALGALRRMEQLIQEAVVTVPRALIA
ETIQLAAVLAGRGSDRRLTELAQVEGLGPDGDYVLKAAGDQP
 
Nucleotide Sequence: 969 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4331922-4330954 Rhodopseudomonas palustris BisB18 chromosome, complete genome
GTGGCAATCCATCATCTCAATCACGAGGCGACATCGCGTGGCGCGCGCATGCTGCGGACCGCATTGGGTC
CGTCGATCGCGCTTTGGCTGGAAGATGCTGAAGTCGTTGAGGTGATGCTCAACCCGGATGGCCGGCTCTG
GATCGACCGGCTGGCAGTTGGACTTGTCGATACCGGGGAACGGTTGTCGGCCCGCGATGGCGAGCGGATC
GTCCGTCTCGTCGCGCACCACGTCGGCGTGGAGGTGCATTCGGCTTCACCGCGCGTCTCGGCAGAGTTGC
CGGAAACCGGCGAGCGTTTCGAGGGATTGCTCCCGCCAGTCGTCGCTGCACCAACCTTTGCGATCCGCAA
GCCCGCGGTCGCGGTCTTCACGCTCGACGACTACGCCGCAGCCGGAATCATGACGGCGTGTCAGGCCGAG
ACCCTGCGCGCGGCCGTCGCGGAGCGCCGTAACATTCTGGTCGCGGGTGGCACCTCGACCGGCAAAACCA
CGCTGACCAATGCGCTGCTGGCGGAAGTTGCCAAGACGTCCGATCGCGTGGTGCTGATCGAGGATACCCG
CGAGCTGCAATGCCAGGCGCCGAATTTCGTCGCGCTACGCACCAAGGACGGCGTGGCCTCGTTGTCGGAC
CTGGTTCGGTCATCGCTGCGGCTTCGGCCCGACCGTATCCCGATCGGTGAGGTGAGGGGTGCCGAGGCGC
TCGACCTGTTGAAGGCCTGGGGCACCGGCCACCCGGGCGGCATCGGTACCATCCATGCAGGCACCGCGCT
CGGCGCGCTGCGCCGGATGGAGCAACTGATCCAGGAAGCCGTCGTCACCGTGCCGCGCGCGCTGATCGCC
GAGACCATTCAACTCGCCGCCGTGCTGGCCGGACGCGGTTCCGATCGCCGCCTGACTGAGCTCGCTCAGG
TCGAGGGCCTCGGCCCTGACGGCGATTACGTGCTCAAAGCCGCAGGAGATCAGCCATGA
 Primer design