SecReT4
Protein ID: 90425378
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3903
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4332509..4334506 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ20ZK7
KEGG IDrpc:RPC_3903
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.8e-99, Aligned region: 113..560
TraG-D_C [PF12696], Evalue: 1.3e-30, Aligned region: 402..523
TrwB_AAD_bind [PF10412], Evalue: 1.1e-28, Aligned region: 173..536
AAA_10 [PF12846], Evalue: 2.8e-05, Aligned region: 148..479
Protein Sequence: 665 a.a.     [Download]
>gi|90425378|ref|YP_533748.1| conjugal transfer coupling protein TraG [Rhodopseudomonas palustris BisB18]
MSATKILWGQIIVVFAVVLITMWAATQWVAWKLGFQPQLGQPWFELLPGVPVYLPPAFFWWWYAYDAYAP
DVFVEGAYIAASGGFLAIAVAIGMSVWRAREVKIAATYGSARWASLPELRAAGLTGPDGVVLGRFEQDYL
RHDGPEHVLCFAPTRSGKGVGLVVPTLLTWPGSCIVHDIKGENWTLTSGYRARHGRVLLFDPTNSRSAAY
NPLLEVRRGEWEVRDVQNVADVLVDPEGSLERRNHWEKTSHALLVGAILHVLYAEPDKTLAGVAGFLSHP
KRPIEATLRAMMTSAHLGEAGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAKVTQHCDWR
ISDLVEGERPVTLYLVVPPSDISRTKPLVRLILNQIGRRLTEDLHPKGRRHRLLLMLDEFPALGRLDFFE
SALAFMAGYGLKSFLIAQSLNQIEKAYGPNNAILDNCHVRVSFATNDERTAKRVSDALGTATEMRAMKNY
AGHRLSPWLGHLMVSRQETARPLLTPGEVMQLPPSDELVLISGCPPIRAKKARYFEDPRLTERILTPPLL
EAKQGSTKPDDDWCRLPSPAAGRDGRISDAPGDDSTGDPANAGIRREPELPDHEEIAPERATPPPEFGFV
EDEPDDEAARARALRRQVRGLARQAAMDPGDGIEL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4334506-4332509 Rhodopseudomonas palustris BisB18 chromosome, complete genome
GTGTCCGCCACCAAGATCCTCTGGGGTCAGATCATCGTCGTCTTCGCGGTCGTCCTCATCACCATGTGGG
CGGCGACGCAATGGGTCGCGTGGAAGCTTGGCTTCCAGCCGCAACTCGGACAGCCCTGGTTTGAGCTGCT
GCCCGGTGTTCCGGTCTATCTTCCTCCGGCGTTTTTCTGGTGGTGGTACGCCTACGACGCCTATGCGCCT
GACGTGTTCGTCGAGGGGGCTTACATCGCGGCGTCAGGTGGGTTCCTGGCGATTGCGGTTGCGATCGGCA
TGTCGGTGTGGCGCGCTCGTGAGGTGAAGATTGCCGCCACCTATGGCTCGGCGCGCTGGGCGTCGCTGCC
TGAGCTTCGTGCCGCCGGTCTCACCGGGCCGGACGGTGTCGTGCTCGGCCGGTTCGAGCAGGACTATTTG
CGTCACGATGGTCCGGAACATGTGCTGTGTTTTGCGCCGACCCGGTCCGGCAAGGGCGTCGGTCTGGTGG
TGCCCACGCTTCTGACGTGGCCGGGCTCATGCATCGTCCATGACATCAAGGGCGAGAACTGGACACTGAC
GTCGGGCTATCGGGCCCGGCATGGCCGGGTGTTGCTTTTCGATCCGACCAATTCGAGGTCGGCGGCCTAC
AACCCGCTGCTCGAGGTTCGCCGCGGCGAGTGGGAGGTCCGCGACGTCCAGAATGTCGCCGATGTGCTGG
TTGACCCCGAGGGCTCGCTGGAGCGGCGCAACCATTGGGAAAAGACCAGCCATGCTCTGCTGGTCGGCGC
AATTCTTCACGTGCTCTATGCCGAACCGGACAAGACGCTCGCCGGTGTTGCCGGCTTTCTGTCCCATCCG
AAGCGGCCGATCGAGGCAACGCTACGGGCGATGATGACGTCGGCGCATCTTGGGGAGGCGGGTCCGCATC
CGGTGATCGCATCTGCCGCTCGCGAGCTCCTCAACAAGAGCGAGAATGAACGATCCGGCGTGCTCTCGAC
CGCGATGTCGTTCCTTGGTCTCTACCGCGATCCGGTGGTGGCGAAGGTGACGCAGCATTGCGACTGGCGC
ATCAGTGATCTGGTCGAGGGCGAGCGTCCCGTCACGCTCTACCTGGTGGTGCCGCCATCCGACATCAGCC
GGACCAAACCGTTGGTGCGGCTGATCCTCAACCAGATCGGCCGTAGGCTCACCGAAGATCTGCATCCGAA
AGGGCGGCGGCATCGATTGCTGCTGATGTTGGACGAATTTCCGGCGCTGGGCCGGTTGGATTTCTTCGAG
TCGGCGTTGGCCTTCATGGCCGGTTATGGGCTGAAAAGCTTTCTGATTGCGCAGTCGCTCAATCAGATCG
AAAAGGCCTACGGGCCCAACAACGCCATTTTGGACAATTGCCACGTCCGGGTCTCGTTTGCCACCAACGA
CGAGCGCACCGCCAAGCGGGTGTCGGATGCGCTTGGCACCGCGACCGAGATGCGGGCGATGAAGAACTAT
GCCGGGCACAGGCTCAGTCCCTGGCTCGGTCATCTGATGGTGTCGCGGCAGGAGACAGCACGACCACTGC
TGACGCCCGGCGAGGTGATGCAACTGCCGCCCAGCGATGAATTGGTGCTGATCTCAGGTTGTCCGCCGAT
CCGGGCCAAGAAGGCGCGCTACTTCGAAGATCCAAGATTGACCGAGCGGATCCTGACGCCGCCGTTGCTG
GAGGCAAAGCAGGGCAGTACGAAGCCAGACGATGACTGGTGCCGATTGCCATCTCCCGCGGCAGGCCGTG
ACGGTCGGATTTCCGACGCGCCGGGAGACGATTCCACGGGTGATCCCGCCAACGCCGGCATCCGCCGGGA
ACCAGAGCTTCCCGACCACGAGGAAATTGCCCCGGAGCGAGCGACCCCGCCACCTGAGTTTGGGTTTGTC
GAAGACGAGCCCGACGACGAAGCAGCCCGTGCCCGTGCATTGCGTCGGCAGGTTCGTGGGCTTGCACGCC
AGGCCGCGATGGATCCCGGCGATGGTATCGAACTCTAG
 Primer design