SecReT4
Protein ID: 90425380
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3905
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4336631..4337536 [-]
Productlytic transglycosylase
Component typeTrbN
UniProt IDQ20ZK5
KEGG IDrpc:RPC_3905
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 301 a.a.     [Download]
>gi|90425380|ref|YP_533750.1| lytic transglycosylase [Rhodopseudomonas palustris BisB18]
MLPSDRILSVFSVRDLNAGHSFLPANARIAIVRMTGAKRRSGRGISGLQPKAAIIRLRRRLAGTMVWIFA
ILASSLSCNGVACADQPARGTQTASQPLADSLAPFITEASERFAIPERWIRAVMRAESSGKMRARSAKGA
IGLMQIMPETWTELRTRYGLGADPYDPHDNILAGAAYLRELHDRYGMAGFIAAYNAGPRRYDDHLATGRS
LPDETQAYVAAIMPMIGIELYAVGSGVITTSLTVARCPLFIMRPASNSTAGRTSSDVRPDGSLSTRAVVD
LSALVPQSSNLFARSASWVRP
 
Nucleotide Sequence: 906 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4337536-4336631 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGTTGCCGTCCGATCGCATCCTCTCTGTTTTTTCTGTACGCGATCTGAATGCGGGTCATTCCTTCCTCC
CGGCCAATGCCCGCATCGCTATCGTGCGCATGACAGGCGCCAAGCGGCGTTCAGGCCGAGGGATTTCTGG
CCTGCAGCCGAAGGCGGCGATCATCCGGCTACGTCGCCGACTTGCCGGTACGATGGTTTGGATCTTCGCG
ATTCTCGCATCATCGCTGTCGTGCAATGGTGTTGCTTGCGCCGACCAGCCAGCACGCGGCACGCAGACCG
CAAGTCAACCGCTTGCCGACTCCCTTGCGCCGTTTATCACCGAGGCCTCCGAACGGTTTGCGATCCCGGA
ACGCTGGATCCGTGCGGTGATGCGGGCTGAGAGCTCTGGCAAGATGCGAGCCCGATCAGCGAAAGGCGCC
ATCGGGCTGATGCAGATTATGCCGGAGACGTGGACGGAATTGCGTACGCGCTACGGTCTCGGTGCTGATC
CCTACGATCCGCACGACAACATCCTGGCTGGCGCTGCTTATCTCCGCGAACTCCATGATCGGTACGGCAT
GGCGGGATTTATTGCCGCCTACAATGCCGGTCCCCGACGTTACGACGACCATCTGGCGACCGGGCGATCG
TTGCCCGATGAGACGCAAGCCTACGTCGCGGCGATCATGCCGATGATCGGGATCGAATTGTATGCTGTCG
GGAGTGGCGTCATCACGACCTCGCTAACGGTGGCACGCTGCCCCCTGTTTATCATGCGCCCGGCAAGTAA
CTCAACTGCTGGTCGGACGTCGTCCGACGTGCGGCCTGATGGTTCACTAAGTACCCGCGCCGTGGTCGAT
CTATCGGCGCTCGTGCCGCAATCGAGCAACCTATTTGCGCGCAGTGCCAGCTGGGTTCGACCGTGA
 Primer design