SecReT4
Protein ID: 90425381
T4SS name [ID]Trb [302]
Gene symbol-
Locus tagRPC_3906
StrainRhodopseudomonas palustris BisB18
Repliconchromosome [GenBank: NC_007925] [Browse all T4SS(s) in this replicon]
Location [Strand]4337536..4338051 [-]
Productconjugal transfer protein
Component typeTraF
UniProt IDQ20ZK4
KEGG IDrpc:RPC_3906
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 5.6e-53, Aligned region: 30..167
Protein Sequence: 171 a.a.     [Download]
>gi|90425381|ref|YP_533751.1| conjugal transfer protein [Rhodopseudomonas palustris BisB18]
MKARKVTFLTTLSAAAILLVSMGEQTPKLFIWNASESVPVGLYRLRPIRKLAVTELVAVQPPEPLAKFLS
EGGYLPRGIPMLKRVLALPGQTVCRNHLLISVDDIALGEALERDRRDRSLPVWQGCHVVAEGEVFLMNLQ
SADSLDGRYFGVTPATAILGRAEPLWTKEEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|90421528|ref|NC_007925.1|:c4338051-4337536 Rhodopseudomonas palustris BisB18 chromosome, complete genome
ATGAAGGCCCGGAAAGTGACATTTCTCACGACGCTATCGGCTGCAGCGATCCTGTTGGTTTCAATGGGCG
AACAAACACCGAAGCTTTTCATCTGGAACGCCTCCGAGAGCGTGCCCGTCGGGCTCTACCGGCTGCGGCC
GATCCGCAAACTTGCCGTCACCGAATTGGTCGCGGTCCAGCCGCCAGAGCCGCTTGCCAAATTCCTGAGC
GAGGGCGGTTATCTACCCCGCGGCATTCCGATGCTGAAGCGCGTGTTGGCGCTACCCGGACAGACGGTTT
GCCGGAATCATCTCCTTATTTCGGTTGACGATATCGCGCTGGGTGAGGCGCTGGAGCGCGACCGCAGAGA
CCGATCGCTGCCGGTCTGGCAGGGCTGCCATGTGGTTGCCGAGGGCGAAGTCTTCCTCATGAACTTGCAG
TCCGCCGACTCGCTCGACGGCCGATATTTCGGCGTGACGCCGGCGACTGCGATCCTCGGACGAGCAGAGC
CTCTCTGGACCAAAGAGGAGGAGTGA
 Primer design