SecReT4
Protein ID: 90576572
T4SS name [ID]VirB [385]
Gene symboltraB
Locus tagNAH7_28
StrainPseudomonas putida plasmid NAH7 (NC_007926)
Repliconplasmid NAH7 [GenBank: NC_007926] [Browse all T4SS(s) in this replicon]
Location [Strand]20573..22132 [+]
Productputative plasmid transfer protein TraB
Component typeVirD4
UniProt IDQ1XGM8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.1e-123, Aligned region: 125..499
TraG-D_C [PF12696], Evalue: 2.4e-20, Aligned region: 363..480
T4SS-DNA_transf [PF02534], Evalue: 1.7e-16, Aligned region: 287..487
AAA_10 [PF12846], Evalue: 4.5e-10, Aligned region: 139..179
Protein Sequence: 519 a.a.     [Download]
>gi|90576572|ref|YP_534814.1| putative plasmid transfer protein TraB [Pseudomonas putida]
MHKREVDSAVMTAGFGLPIAGWAAGVYFAQMPLTPFPAAFKETLHNGWHNPIVLGATIATSAVAASLVYY
LYEYCDDGFRGEQYQEFLRGSEIKNWHTVKAKVRRRNEKTNRERKKWGLAKSEPIMIGKLPMPLHLEDRN
TMICASIGAGKSVTMEGMIASALKRGDRLAVVDPNGTFYSKFSFKGDSILNPFDERSVGWTIFNEIRGIH
DFNRMAKSIIPPQVDPSDEQWCAYARDVLSDTMRKLKETNNPDQDTLVNLLVREDGDTIRAFLANTDSEG
YFRDNAEKAIASIQFMMNKYIRPLRYMSKGEFSIYKWVNDPNAGNLFITWREDMRDTMKPLVATWIDTIC
ATILSSEPMTGKRLWLFLDELQSLGKLESFVPAATKGRKHGLRMVGSLQDWSQLNASYGRDDAETLLSCF
RNYVILAAANAKNAGMASEILGSHDVKRWRKSYTAGKLTRTEEVTRDEPVVQASEISNLPDLVAYVKFGE
DFPITKVKTPYIDYKERAQAIMLTGQAAA
 
Nucleotide Sequence: 1560 bp     [Download]
>gi|90576544|ref|NC_007926.1|:20573-22132 Pseudomonas putida plasmid NAH7, complete sequence
ATGCATAAAAGAGAAGTCGATTCTGCAGTGATGACAGCCGGTTTCGGTTTGCCGATCGCTGGATGGGCAG
CAGGCGTTTATTTTGCACAGATGCCGTTGACGCCATTCCCAGCAGCGTTCAAAGAAACGCTTCACAACGG
CTGGCACAACCCGATTGTACTGGGGGCCACAATTGCCACGTCAGCGGTAGCCGCTTCGCTGGTTTATTAC
CTGTACGAATATTGTGACGATGGGTTTCGAGGCGAGCAGTACCAGGAATTTCTACGGGGTTCGGAGATAA
AGAACTGGCACACCGTCAAGGCAAAGGTGCGCCGCCGTAACGAAAAGACCAATCGCGAGCGTAAAAAATG
GGGCTTGGCCAAGTCTGAGCCGATCATGATTGGCAAGCTGCCTATGCCTCTGCACCTTGAAGATCGAAAC
ACAATGATCTGCGCGTCCATCGGTGCCGGTAAGTCGGTGACCATGGAAGGCATGATCGCCTCGGCATTGA
AGCGGGGTGATCGCTTGGCCGTTGTCGACCCGAACGGTACGTTCTATTCAAAATTCAGCTTCAAAGGGGA
CAGCATTCTCAACCCCTTCGATGAACGCTCGGTAGGGTGGACGATCTTCAACGAGATCCGTGGCATCCAT
GACTTCAACCGGATGGCCAAGTCGATAATTCCGCCCCAGGTCGATCCGAGTGATGAGCAATGGTGCGCGT
ACGCTCGCGACGTACTGTCCGACACCATGCGCAAGCTCAAAGAAACCAACAACCCGGACCAAGATACGCT
GGTGAACTTGCTGGTGCGGGAGGATGGCGACACCATCCGCGCCTTCCTGGCCAACACTGACTCCGAGGGC
TATTTCCGCGACAACGCAGAGAAGGCTATCGCGAGCATCCAGTTCATGATGAACAAGTACATTCGACCCC
TGCGCTACATGAGCAAGGGTGAATTCTCCATCTATAAATGGGTGAACGATCCGAATGCCGGCAATCTGTT
TATCACTTGGCGGGAGGACATGCGGGACACCATGAAACCGCTGGTGGCCACGTGGATTGACACCATCTGC
GCCACGATCCTCAGCTCTGAGCCGATGACAGGCAAACGGCTATGGCTGTTCCTCGACGAGCTGCAGTCCC
TAGGCAAACTGGAGAGCTTTGTTCCAGCGGCGACAAAAGGCCGGAAGCACGGTCTGCGTATGGTCGGCAG
TCTGCAGGATTGGTCCCAGCTCAACGCCAGTTACGGGCGTGACGATGCGGAAACGCTGCTGTCGTGCTTC
CGAAACTACGTCATCCTTGCTGCAGCGAACGCCAAGAACGCAGGTATGGCCAGCGAAATCCTCGGCTCTC
ACGATGTGAAGCGTTGGCGGAAATCGTACACCGCTGGCAAGTTGACCAGGACCGAGGAAGTAACGCGGGA
TGAACCGGTGGTTCAGGCTTCTGAAATCTCCAACCTTCCGGATCTGGTCGCCTATGTGAAATTCGGTGAA
GACTTCCCGATCACCAAGGTGAAGACGCCGTACATCGATTACAAAGAGCGTGCCCAGGCAATCATGCTTA
CCGGTCAAGCAGCAGCATAA
 Primer design