SecReT4
Protein ID: 90576617
T4SS name [ID]VirB [385]
Gene symbolmpfI
Locus tagNAH7_73
StrainPseudomonas putida plasmid NAH7 (NC_007926)
Repliconplasmid NAH7 [GenBank: NC_007926] [Browse all T4SS(s) in this replicon]
Location [Strand]71886..72914 [-]
Productputative mating pair formation protein MpfI
Component typeVirB11
UniProt IDQ1XGI3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.3e-59, Aligned region: 15..322
Protein Sequence: 342 a.a.     [Download]
>gi|90576617|ref|YP_534859.1| putative mating pair formation protein MpfI [Pseudomonas putida]
MSEIASFRQKLRSFDFLLDDPAVSEIAINGPGNVWAAYRGSRFMRPVAVDGVTLPLIKSLAELIAAHTEQ
EVNAYTPILSGRIPMDMSDHVADSERGDYRVQCVLAPAVEQHIGGIVCIRKPGRVQLTMDQYIASGAFDQ
INEARTPDQYSDDHLVELYRAKRWSEFFIGCVKAHKNIMISAGTNAGKSTFLNMLLQHVDPNERIVTIED
TREIRLKSENVVHLIYSRGGQGKARVTPFDHLESILRLTPDRAIMGELRGAEAYPYLELLNTGHSGSFST
IHSDSPDLMFDRLASMASRGGSDMTKNQLVEFSRHLIDVVIQWEYGFDGRRFITEVQYAKAA
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|90576544|ref|NC_007926.1|:c72914-71886 Pseudomonas putida plasmid NAH7, complete sequence
ATGTCTGAGATTGCTTCGTTCCGCCAAAAGCTGCGCAGTTTTGATTTTCTGCTCGATGACCCAGCGGTAT
CCGAGATCGCTATCAACGGTCCAGGCAACGTATGGGCCGCGTATCGCGGTAGCCGCTTCATGCGCCCCGT
CGCTGTGGATGGCGTCACCCTTCCGCTTATCAAGTCGCTAGCCGAGTTGATTGCGGCGCATACAGAGCAA
GAGGTCAACGCTTATACGCCGATCCTGTCCGGTCGCATCCCTATGGACATGAGCGACCACGTAGCGGACT
CGGAACGTGGCGACTATCGGGTCCAGTGCGTGCTTGCGCCTGCCGTTGAGCAACATATCGGCGGCATCGT
CTGTATTCGTAAACCTGGCCGCGTTCAGCTGACGATGGATCAATACATCGCTTCGGGAGCGTTTGACCAG
ATCAACGAGGCACGCACGCCAGATCAGTACAGCGATGATCACCTGGTCGAGTTGTACCGCGCCAAGCGCT
GGTCGGAATTTTTCATTGGGTGCGTCAAGGCCCACAAAAACATCATGATTTCGGCAGGGACAAACGCGGG
CAAAAGCACCTTCCTCAACATGCTGTTGCAGCATGTAGACCCTAATGAGCGGATCGTCACAATCGAAGAT
ACCCGCGAGATCCGTCTCAAAAGCGAGAACGTGGTTCATTTGATCTATTCCCGAGGTGGCCAAGGCAAAG
CGCGGGTCACGCCGTTTGATCACCTTGAGTCGATTCTTCGTCTTACCCCTGACCGCGCAATCATGGGCGA
GCTTCGCGGTGCTGAGGCTTACCCCTATCTTGAATTGCTGAACACCGGCCATAGCGGTTCATTCAGCACT
ATCCACTCGGACAGCCCCGACCTGATGTTTGACCGGCTTGCGTCGATGGCATCGCGTGGCGGCTCCGACA
TGACCAAAAACCAACTTGTGGAATTCTCACGTCACCTGATCGACGTAGTGATCCAGTGGGAGTACGGCTT
CGATGGCCGTCGATTCATCACGGAGGTGCAATATGCAAAAGCTGCCTAA
 Primer design