SecReT4
Protein ID: 90576620
T4SS name [ID]VirB [385]
Gene symbolmpfF
Locus tagNAH7_76
StrainPseudomonas putida plasmid NAH7 (NC_007926)
Repliconplasmid NAH7 [GenBank: NC_007926] [Browse all T4SS(s) in this replicon]
Location [Strand]75026..75691 [-]
Productputative mating pair formation protein MpfF
Component typeVirB8
UniProt IDQ1XGI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-41, Aligned region: 11..217
Protein Sequence: 221 a.a.     [Download]
>gi|90576620|ref|YP_534862.1| putative mating pair formation protein MpfF [Pseudomonas putida]
MDKELKKDEIARRKRQLEHKRVKQERNRSYFMNGAFALALVGAGIAIAFLAESKTFINVVTVIGADGEVL
KQRTVTAENVDKEQAIIEGVLFDFIRACNTFDPRRKQQLSDTCHTYMTRNVAVEYEKEISPDNARNPYAS
LGENDWIEAQPKRMNKIGDEYQVIFLSTNHKWGDKEPTVTSYLATIKVAHTMIPRALGDRWENPFGTLAT
LYRKSEELSRQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|90576544|ref|NC_007926.1|:c75691-75026 Pseudomonas putida plasmid NAH7, complete sequence
ATGGACAAGGAATTAAAGAAAGATGAGATTGCGCGCCGTAAGCGCCAACTCGAACACAAGAGGGTTAAAC
AAGAACGTAACCGTAGTTACTTTATGAATGGTGCGTTCGCTCTTGCTCTGGTTGGGGCGGGCATAGCCAT
TGCGTTCCTGGCTGAATCAAAGACGTTCATCAATGTGGTAACGGTGATCGGCGCCGATGGTGAAGTGCTC
AAGCAGCGCACGGTTACGGCGGAAAACGTCGACAAAGAGCAGGCCATCATCGAAGGCGTTCTGTTTGATT
TCATTCGTGCTTGTAACACCTTCGACCCTCGGCGCAAGCAACAGTTGTCCGATACCTGCCACACCTACAT
GACCCGCAACGTCGCTGTCGAATATGAGAAGGAGATCAGCCCTGATAACGCGCGCAATCCATACGCATCG
CTCGGGGAAAACGACTGGATCGAAGCCCAACCCAAGCGCATGAACAAGATTGGCGATGAGTATCAGGTGA
TTTTCCTATCAACCAATCACAAGTGGGGTGACAAAGAGCCAACGGTTACTTCCTACCTGGCAACGATAAA
GGTTGCACACACGATGATCCCTAGAGCTTTGGGTGATCGTTGGGAAAACCCGTTTGGCACCTTGGCAACT
TTATACCGTAAGAGTGAAGAACTGAGCCGCCAGTAA
 Primer design