SecReT4
Protein ID: 91204895
T4SS name [ID]VirB [492]
Gene symbolvirB4-2
Locus tagRBE_0080
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]87297..89720 [+]
ProductVirB4
Component typeVirB4
UniProt IDQ1RKF3
KEGG IDrbe:RBE_0080
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.4e-41, Aligned region: 183..383
AAA_10 [PF12846], Evalue: 5.4e-09, Aligned region: 436..604
Protein Sequence: 807 a.a.     [Download]
>gi|91204895|ref|YP_537250.1| VirB4 [Rickettsia bellii RML369-C]
MFSGLRKFDKDIYNYNAPNFIPIACHYNEHTLLTKDGKLLQIIKVYGISSEKISDKIQNLREIIRASVKK
HTNSYDFAFWMHTIREKQNLDDPTPYKKLLPANIHALWQRKNHWNDKFVNTLYISIVHDSAKIKIKNFGS
LINSLSTKLIVDFENKYLESAVQKLESLANNILNDLNEFDAEKLGITFENENTFSAPLFLYNRIANINDS
DCLVPIIDLSSAIGRSTYTISGDKMIVTNQEQNKKFISLLSIKEYQESPSEALDKFLQLPLELIITEIFY
FVDKKVVTAALKGQDYILKITNDNNLIEHKGINKLNDNKSSFEFCNQQISIAVIEEDEDKLTASVAKAAR
ELFKLGIVHVKEDLNIEQTFWAQLPANFAFIRRMSPLLSDHIASLAALHNSPLGSQYTSWGRALTLLRTE
RGTPYFMNFHDKTGRGNTCIFGTEKTGKTVLLNFLVSESTKYDPTIIYISNSNDSKIFIEALEGTWLEID
KQIINPFLVDDTEKSQAFILEFLKMLSGHYISPLNEVELTFLEKLRSKILSIDKEKRIFSDILKLEDFKE
EGGSTILDKLKGFTEGQLYSGLFDQSVFNINESSIVGLNLYKLSDEPFAKQFYPSERKYLEQFNNNLKKH
QSVCASVVYALTYHLSLVGTKPKIFAADSFDKLYKPEIYSDNISLIFNNLSENNGVFVGNFNFIYLKKYT
LKAWLEIINTKIILPSDVKIEDLDEILGLTDSEIRKLSQLILTSRMFLINKDNESIALELSIAALVGVVR
ILSSKKEEMAIYKEVLEKYQGPPDNWINYLYDALNVD
 
Nucleotide Sequence: 2424 bp     [Download]
>gi|91204815|ref|NC_007940.1|:87297-89720 Rickettsia bellii RML369-C chromosome, complete genome
GTGTTTAGTGGTTTACGAAAGTTTGATAAGGATATATATAATTATAATGCTCCGAATTTTATACCTATAG
CATGTCACTATAATGAGCATACTTTGCTTACCAAGGATGGTAAGTTACTACAAATTATTAAAGTCTATGG
TATCAGTTCGGAAAAAATTAGTGATAAAATACAAAATTTACGTGAAATAATTAGAGCTTCCGTAAAAAAG
CATACAAATAGTTATGATTTTGCTTTTTGGATGCATACAATAAGAGAAAAACAAAATTTAGACGATCCTA
CTCCGTATAAAAAATTATTACCTGCTAACATCCATGCATTATGGCAGAGAAAAAACCACTGGAATGATAA
ATTTGTTAATACTTTATATATTTCCATAGTACATGATTCTGCCAAGATTAAGATTAAAAATTTTGGCTCT
CTGATAAATTCTTTATCAACTAAATTAATCGTAGACTTTGAAAATAAATATTTAGAGTCTGCTGTTCAGA
AGCTAGAAAGTCTTGCTAATAATATTTTGAATGACTTAAATGAATTTGATGCAGAAAAGCTTGGTATAAC
ATTTGAAAATGAAAACACATTTTCTGCACCTTTATTTTTATATAACCGAATAGCTAATATTAACGATAGT
GATTGTTTAGTACCTATAATAGATTTATCAAGTGCAATAGGTAGAAGTACTTATACGATTAGTGGCGATA
AAATGATAGTCACGAATCAGGAACAGAATAAAAAATTTATTTCCTTGTTATCTATCAAAGAATATCAAGA
ATCTCCTTCTGAAGCTCTTGATAAGTTTTTGCAGCTGCCGCTTGAATTAATAATAACCGAGATATTTTAC
TTTGTTGATAAAAAAGTAGTGACTGCTGCTTTAAAGGGGCAGGATTATATTTTAAAAATTACTAATGATA
ATAACTTGATTGAGCATAAAGGGATTAATAAACTTAATGATAATAAATCTTCTTTTGAGTTTTGTAATCA
ACAGATTTCAATTGCTGTTATAGAAGAAGATGAAGATAAACTTACTGCTTCTGTTGCAAAAGCTGCAAGA
GAGCTTTTTAAACTTGGTATTGTTCATGTAAAAGAAGATCTTAATATAGAACAAACATTTTGGGCACAAT
TACCGGCTAATTTTGCTTTCATACGAAGAATGTCGCCTTTATTGTCAGATCATATAGCATCTCTTGCTGC
TCTGCACAACTCACCTTTAGGTAGCCAATATACTTCTTGGGGACGAGCATTAACACTACTTAGAACAGAA
AGAGGTACTCCTTATTTCATGAATTTTCATGATAAAACTGGTAGGGGTAATACTTGTATTTTTGGTACAG
AAAAAACTGGTAAAACAGTATTATTAAATTTTCTGGTGTCGGAATCAACTAAGTATGATCCAACAATAAT
TTATATCTCTAATAGCAATGATTCTAAGATTTTTATCGAAGCATTAGAGGGTACATGGTTAGAAATTGAT
AAGCAAATTATCAATCCATTTTTAGTAGATGATACAGAAAAATCGCAAGCTTTTATTTTAGAGTTTTTAA
AGATGTTAAGTGGTCATTATATTTCACCGCTTAATGAAGTAGAACTAACTTTTTTAGAAAAACTCAGAAG
TAAAATTTTATCAATTGATAAAGAAAAGCGAATTTTTTCTGACATCTTAAAATTGGAAGATTTTAAAGAA
GAGGGTGGCAGTACAATATTAGATAAATTAAAAGGCTTCACTGAGGGACAATTATATAGCGGTTTATTTG
ACCAGTCAGTTTTTAATATTAATGAAAGTAGTATTGTCGGTCTTAATTTATACAAGCTTTCAGATGAACC
TTTTGCTAAGCAATTTTATCCAAGTGAAAGAAAATATTTAGAACAATTTAATAATAACTTAAAAAAACAT
CAAAGTGTTTGTGCTAGTGTAGTTTATGCACTTACTTACCATTTAAGCTTAGTAGGTACTAAACCTAAAA
TATTCGCTGCAGATAGTTTTGATAAACTCTATAAACCTGAAATTTATAGTGATAATATAAGCTTAATTTT
TAATAATTTATCTGAAAATAATGGTGTCTTTGTAGGTAATTTTAATTTTATTTACCTTAAGAAATATACT
TTAAAAGCATGGCTTGAAATAATTAATACTAAAATTATTTTACCGTCTGATGTAAAAATCGAAGATCTAG
ATGAGATTTTAGGTTTAACAGATTCAGAAATACGTAAGTTATCGCAATTAATACTTACCAGTAGAATGTT
TTTAATTAATAAAGATAATGAATCTATAGCTTTAGAATTAAGTATAGCAGCATTAGTCGGGGTCGTGCGT
ATTTTATCAAGTAAAAAGGAAGAAATGGCTATCTATAAAGAAGTGCTAGAAAAATACCAAGGACCGCCAG
ATAATTGGATTAATTATCTATACGATGCACTAAACGTAGACTAG
 Primer design