SecReT4
Protein ID: 91205242
T4SS name [ID]Tra_F [543]
Gene symboltraF
Locus tagRBE_0427
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]483432..484334 [-]
ProductF pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ1RJF6
KEGG IDrbe:RBE_0427
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.5e-59, Aligned region: 68..284
Protein Sequence: 300 a.a.     [Download]
>gi|91205242|ref|YP_537597.1| F pilus assembly protein TraF [Rickettsia bellii RML369-C]
MMKWLVNTITKSSLAITSLVIILLLLINDWSNHAFAGTIDLNANSINKMIGLDLASNNEVKDSTQPKGFL
WYNEDHAYKPEILKFSQDQKKQEPELELYDQRIEALKKEFNRAKRKALDDPTLENVIIAQRLHKQILEKS
YKFATMWQLATLLDYSLTNENIPANSLHKKLYEIRQDKDSSQKLRFLAKNWGLILQVNQGCNYCQAFIPI
VREFADKYGFQLIFVSNSETRFQGIPTIKDTGLLQTLNPAKLVPVLYLIDSSGIQIYPVARGIISEDKIA
ENILLVIQHYNRLKVNDYDQ
 
Nucleotide Sequence: 903 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c484334-483432 Rickettsia bellii RML369-C chromosome, complete genome
ATGATGAAGTGGCTAGTAAACACGATAACTAAATCATCACTAGCCATTACATCACTAGTAATTATTTTAT
TGTTACTAATCAATGATTGGTCAAATCACGCATTTGCTGGTACTATAGACTTAAATGCTAATAGTATAAA
TAAAATGATAGGATTAGATTTAGCAAGCAACAATGAAGTAAAAGATAGCACTCAACCAAAAGGTTTTCTT
TGGTATAATGAGGATCATGCTTACAAGCCAGAAATATTAAAATTTTCTCAAGATCAAAAAAAGCAAGAGC
CAGAACTTGAGCTTTATGATCAAAGGATAGAAGCTTTAAAGAAGGAATTTAATAGAGCTAAGCGTAAAGC
CTTAGATGATCCTACTCTTGAAAATGTCATTATTGCTCAAAGGTTACACAAACAAATTTTAGAAAAATCA
TATAAATTTGCTACCATGTGGCAGCTTGCTACCTTACTTGATTATAGTCTTACAAACGAGAATATACCTG
CAAATTCATTGCATAAAAAATTATACGAGATAAGACAAGATAAAGACAGCAGCCAAAAACTAAGATTTTT
AGCTAAGAATTGGGGATTAATTCTGCAAGTAAATCAAGGATGTAATTACTGCCAGGCATTTATCCCTATT
GTAAGAGAATTTGCAGATAAATATGGCTTTCAATTAATTTTTGTAAGTAATAGTGAAACTAGATTTCAAG
GGATACCAACCATTAAAGATACTGGTTTGTTACAAACACTAAATCCTGCAAAGCTTGTACCGGTATTATA
TTTAATCGATAGCAGCGGCATACAAATATATCCAGTTGCAAGAGGAATTATTAGTGAAGATAAAATTGCT
GAAAATATTTTATTGGTAATTCAGCACTATAATAGACTAAAGGTTAATGATTATGATCAGTAA
 Primer design