SecReT4
Protein ID: 91205827
T4SS name [ID]VirB [492]
Gene symbolvirB9-1
Locus tagRBE_1012
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1110609..1111361 [-]
ProductVirB9
Component typeVirB9
UniProt IDQ1RHS1
KEGG IDrbe:RBE_1012
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-61, Aligned region: 29..245
Protein Sequence: 250 a.a.     [Download]
>gi|91205827|ref|YP_538182.1| VirB9 [Rickettsia bellii RML369-C]
MKQLIIFFTIIFFTLNIFAIRESRPLGQDSRLRVMVYNPDDVFKFTGYYGYQASIELARDEEIVSISMGD
TTSWQIVPAGHRIFIKPMEQDATTNMTLITNKRTYFFELYAAETLDMRDPEMVFNVKFLYPDDENDNAGG
HMQTYIASSATPDLNHPEKYNFNYYISGSEEIAPIKIFDDGEFTYLQFRDKNSEIPGIFAVDDSLRESLV
NYRLAPDNPNLVILEQVFPKLAVRKGKKITCIFNESFRAY
 
Nucleotide Sequence: 753 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1111361-1110609 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAGCAATTAATAATATTTTTTACAATAATATTTTTTACATTAAATATATTTGCTATTAGAGAGTCAA
GACCTTTGGGGCAAGATTCTCGTTTAAGAGTTATGGTTTATAACCCTGATGATGTTTTTAAATTTACAGG
ATATTACGGCTATCAAGCAAGTATAGAACTTGCAAGAGATGAAGAAATAGTGAGTATCTCTATGGGTGAT
ACTACCTCATGGCAAATAGTACCTGCAGGTCATAGGATTTTTATTAAACCTATGGAGCAGGACGCTACCA
CTAATATGACCTTAATTACTAATAAACGAACATATTTCTTTGAACTATACGCTGCTGAGACTCTTGATAT
GCGTGATCCAGAAATGGTTTTTAACGTCAAGTTCCTCTATCCTGATGATGAAAATGATAATGCTGGTGGT
CACATGCAAACTTATATTGCCTCTTCAGCAACCCCTGATCTTAATCATCCAGAAAAATATAACTTCAACT
ATTATATTAGCGGTAGTGAAGAAATAGCTCCTATTAAAATTTTTGACGATGGCGAATTCACCTATCTACA
ATTTAGAGATAAAAATTCTGAAATTCCTGGGATTTTTGCTGTAGATGATTCACTGCGTGAGTCTTTAGTA
AATTATCGCCTCGCTCCAGATAACCCTAATTTAGTTATTCTTGAACAAGTATTCCCAAAACTTGCCGTAC
GTAAAGGTAAAAAGATTACTTGTATATTCAATGAATCTTTTAGAGCATACTGA
 Primer design