SecReT4
Protein ID: 91205828
T4SS name [ID]VirB [492]
Gene symbolvirB8-1
Locus tagRBE_1013
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1111363..1112067 [-]
Productvirulence protein
Component typeVirB8
UniProt IDQ1RHS0
KEGG IDrbe:RBE_1013
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.4e-13, Aligned region: 22..201
Protein Sequence: 234 a.a.     [Download]
>gi|91205828|ref|YP_538183.1| virulence protein [Rickettsia bellii RML369-C]
MDPVLSAVQEYVKSGEYFSDARKWYSFKYVVPLSSRSLLLLACATFTLLLAIICINIDVLLPINEKISYL
IKCSTEKQATITITNTKESTLRDPYGSVANIMLKNYVLQREEYNYDLLKQQFVFIKNSSTSIVYMQFANF
MNIDNPLSPVMRYQKLYRRSISITSIQNINNNEVVVTFESLAKNSAGEVLENMLWEAKIGYIMDSISANL
PPNASFNFTVTSYKLKLLKDKNQK
 
Nucleotide Sequence: 705 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1112067-1111363 Rickettsia bellii RML369-C chromosome, complete genome
ATGGATCCAGTACTTAGTGCCGTACAAGAATATGTTAAATCCGGCGAATATTTTAGTGATGCAAGAAAAT
GGTACAGCTTTAAATATGTAGTGCCGTTAAGTAGTAGGTCTCTTTTACTTTTAGCATGTGCAACATTTAC
ATTATTACTTGCTATAATTTGTATAAATATTGATGTATTATTACCTATAAACGAAAAAATAAGCTACTTG
ATAAAATGTAGTACCGAAAAACAAGCTACTATTACTATTACTAATACTAAAGAATCTACATTGCGTGATC
CTTATGGTTCTGTTGCTAATATTATGCTCAAAAATTATGTGCTACAGCGAGAAGAATATAATTATGATTT
ATTAAAACAACAATTTGTCTTTATTAAAAATAGTTCTACAAGTATTGTTTATATGCAATTTGCTAATTTT
ATGAATATTGATAACCCACTATCACCGGTTATGCGATATCAAAAATTATATAGGCGTTCAATTAGTATAA
CATCAATTCAGAATATAAATAATAATGAAGTAGTTGTTACTTTTGAGTCATTAGCTAAAAATAGTGCAGG
GGAAGTTTTAGAAAATATGTTATGGGAAGCAAAAATAGGTTATATAATGGATTCTATCAGTGCAAATCTT
CCGCCTAATGCTTCATTTAACTTTACTGTTACCAGTTATAAGCTAAAATTATTAAAAGATAAAAACCAGA
AATAA
 Primer design