SecReT4
Protein ID: 91205829
T4SS name [ID]VirB [492]
Gene symbolvirB8-2
Locus tagRBE_1014
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1112665..1113384 [+]
Productvirulence protein
Component typeVirB8
UniProt IDQ1RHR9
KEGG IDrbe:RBE_1014
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-44, Aligned region: 33..237
Protein Sequence: 239 a.a.     [Download]
>gi|91205829|ref|YP_538184.1| virulence protein [Rickettsia bellii RML369-C]
MLDNIFGFFKSSDKAQNDAKSEQNQANPLKITQNWYEERADKLIVQRNLLIILLIILLIFMIISTLVIAF
VVKSKQFDPFVIQLDDTTGRASVVEPISSPVLTADESLTRYFIKKYINARETYNFVDFTTLARTTIRLLS
TSNLFYGYLGYIRDKNNDPSLKYQENNTTYLVVKSWSKIASDKYIVRFSVNEATGNQTVYNKIAVVSYAY
VPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 720 bp     [Download]
>gi|91204815|ref|NC_007940.1|:1112665-1113384 Rickettsia bellii RML369-C chromosome, complete genome
ATGTTAGATAATATATTCGGCTTCTTTAAATCAAGTGATAAAGCACAAAATGATGCAAAGAGCGAGCAAA
ACCAAGCAAATCCGCTAAAGATAACTCAAAATTGGTATGAAGAACGTGCTGATAAGCTGATTGTTCAACG
TAACTTATTAATAATATTACTGATAATATTATTAATTTTTATGATAATATCTACTTTAGTAATAGCTTTT
GTGGTAAAATCTAAACAATTTGATCCTTTTGTCATTCAACTTGATGACACTACCGGTCGTGCATCAGTAG
TAGAGCCTATTTCATCACCAGTGCTTACTGCAGATGAGTCTCTTACAAGATATTTTATAAAAAAATATAT
AAATGCAAGAGAAACATATAATTTTGTTGATTTCACTACCTTGGCACGCACTACTATAAGATTACTTTCA
ACAAGTAATCTTTTTTATGGTTATCTTGGGTATATAAGAGATAAAAACAACGATCCAAGTTTAAAGTATC
AGGAAAATAATACGACTTATTTAGTAGTAAAGTCATGGTCAAAAATTGCCTCAGACAAATATATAGTTAG
ATTTTCCGTAAATGAAGCAACAGGAAATCAAACAGTTTATAATAAAATAGCAGTAGTAAGTTATGCTTAC
GTACCAATGCAATTAACAGATTCAGAACTTGATATAAATCCTGTAGGATTTCAAGTTAACGGATATAGGG
TAGACGATGATAATAGTTAG
 Primer design