SecReT4
Protein ID: 91205830
T4SS name [ID]VirB [492]
Gene symbolvirB9-2
Locus tagRBE_1015
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1113371..1113856 [+]
ProductVirB9
Component typeVirB9
UniProt IDQ1RHR8
KEGG IDrbe:RBE_1015
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-30, Aligned region: 47..152
Protein Sequence: 161 a.a.     [Download]
>gi|91205830|ref|YP_538185.1| VirB9 [Rickettsia bellii RML369-C]
MIIVRFCFLIFIYLSGLIANADCPLLENDPCSNISNNYLDDLSITRDNRIQTYIYNPNEVYLLTLHFGFQ
AHIEFAKNEEVQNIILGDAYAWKLTPIGNRLFIKPLEKYIRTNMTIITNKRTYEFDISSVELMEGHEKEL
VYVIKFDYSKNRTSNNYMARY
 
Nucleotide Sequence: 486 bp     [Download]
>gi|91204815|ref|NC_007940.1|:1113371-1113856 Rickettsia bellii RML369-C chromosome, complete genome
ATGATAATAGTTAGATTTTGTTTTTTAATTTTTATATACTTAAGTGGCTTAATAGCTAATGCTGACTGTC
CACTTTTAGAAAATGATCCATGTAGTAATATCAGTAATAATTATTTGGATGATTTATCTATAACTAGAGA
TAATAGGATACAAACATATATATATAATCCTAATGAAGTTTATTTATTAACATTGCATTTCGGCTTTCAA
GCACATATAGAATTTGCTAAAAATGAAGAAGTTCAAAATATCATCCTTGGAGACGCCTATGCATGGAAAC
TAACTCCTATTGGTAATCGTTTATTTATAAAACCTCTTGAAAAATATATTCGTACTAACATGACTATCAT
AACTAACAAAAGAACATATGAATTTGATATTTCTTCTGTTGAGTTGATGGAAGGGCATGAGAAAGAGTTA
GTATATGTAATTAAATTTGACTATTCTAAGAATAGAACAAGCAATAATTACATGGCAAGGTACTAG
 Primer design