SecReT4
Protein ID: 91205831
T4SS name [ID]VirB [492]
Gene symbolvirB10
Locus tagRBE_1016
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1113963..1115396 [+]
ProductVirB10
Component typeVirB10
UniProt IDQ1RHR7
KEGG IDrbe:RBE_1016
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.5e-37, Aligned region: 187..465
Protein Sequence: 477 a.a.     [Download]
>gi|91205831|ref|YP_538186.1| VirB10 [Rickettsia bellii RML369-C]
MAEEQNNNSSLSGADTPEVQKELSKVSVSFNKSIAIVVVICGILIYIFYSLFFAPKKEEIQNTNIPSNIV
KPVEDNSDNVPEIPKLPDPPKLETPTAPPPPPTVEVPPVLPPTTPVETDKSKTLPAPPILLPSTNEPLVE
SDEEKKRKQAKRTSSIVLVSGVEPKKTAEQVAADAVFKDRGDMSLILGRGKLIEAVLETAINSDLGGEIR
AIISRDVYSEKDKIILIPKGSKVFGKYATSTSADSYGRVSVIWDRIDLTNGYTIAFDSPAVDNLGRPGVQ
GRVDNKYKEQFANSVLQSAFNIGIAKVLDKLVPPPINSQAAATNSAIATQLLNTAQTISQNTSLDPNTRI
VTICTNVLAAITDKTSTAYTTMTQACTTAQDASSANTPEQRLATLVQAVNTAASSLLTSTSIASNPTQAQ
QASTQAFTDITNTVQNMITQQQFKPTTTINQGTPIKIYVNKDYKFPATVLTKSKVVK
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|91204815|ref|NC_007940.1|:1113963-1115396 Rickettsia bellii RML369-C chromosome, complete genome
ATGGCCGAAGAGCAAAACAATAACAGTTCTTTATCAGGAGCAGATACACCTGAAGTTCAAAAAGAATTAT
CAAAAGTTTCAGTGAGTTTTAATAAAAGTATCGCTATCGTAGTTGTAATTTGCGGTATTCTTATATATAT
TTTTTATTCTCTTTTCTTTGCTCCTAAAAAGGAAGAAATTCAAAATACTAATATACCTAGCAATATTGTT
AAACCTGTTGAAGATAATTCAGATAACGTACCTGAAATACCTAAATTACCGGATCCACCAAAACTTGAGA
CACCGACAGCTCCACCTCCTCCACCTACAGTGGAAGTACCACCAGTTTTACCTCCAACTACCCCAGTAGA
AACGGATAAGTCAAAAACACTTCCAGCTCCACCTATTTTGTTACCTTCAACAAACGAACCTTTAGTTGAA
AGTGACGAAGAAAAGAAGCGTAAACAAGCAAAAAGAACATCATCTATTGTGCTAGTTAGCGGCGTAGAAC
CTAAGAAGACAGCTGAACAAGTTGCTGCGGATGCAGTATTTAAAGATCGTGGTGACATGTCTTTAATCTT
AGGGCGTGGTAAATTAATTGAGGCAGTACTTGAAACAGCCATAAATAGCGATCTTGGTGGCGAAATAAGA
GCTATTATTAGTAGAGATGTATATTCTGAGAAAGATAAGATAATATTAATACCAAAAGGATCGAAAGTAT
TTGGTAAATATGCAACTTCAACTTCAGCAGATAGCTATGGCAGAGTTTCTGTAATATGGGATAGAATAGA
CTTAACTAATGGCTATACTATAGCATTTGATTCACCTGCAGTTGATAATTTAGGAAGACCAGGGGTACAA
GGAAGAGTAGATAATAAATATAAGGAACAGTTTGCTAATTCAGTATTACAATCTGCTTTCAATATAGGAA
TTGCTAAAGTTCTTGATAAATTAGTACCTCCGCCTATAAACTCACAAGCTGCTGCTACTAATAGTGCTAT
TGCTACTCAGTTATTAAATACTGCTCAAACAATTTCCCAAAATACTAGTTTGGATCCAAATACAAGAATA
GTTACAATTTGTACAAATGTTTTAGCTGCTATTACTGATAAAACATCTACTGCCTATACTACAATGACAC
AAGCCTGTACAACTGCCCAAGATGCTTCTTCGGCAAATACACCTGAACAGAGACTAGCTACATTAGTACA
AGCGGTTAATACAGCTGCTTCAAGCTTGCTTACTAGTACTTCTATAGCATCGAATCCAACTCAGGCACAG
CAAGCTTCTACGCAAGCTTTTACAGATATTACTAATACTGTACAAAATATGATAACTCAGCAGCAATTTA
AACCTACTACAACGATTAATCAAGGTACTCCGATTAAGATATACGTTAATAAGGATTATAAATTCCCTGC
TACCGTATTAACAAAATCAAAGGTAGTAAAATGA
 Primer design