SecReT4
Protein ID: 91205832
T4SS name [ID]VirB [492]
Gene symbolvirB11
Locus tagRBE_1017
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1115393..1116397 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ1RHR6
KEGG IDrbe:RBE_1017
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-92, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|91205832|ref|YP_538187.1| type IV secretion system ATPase VirB11 [Rickettsia bellii RML369-C]
MSDAFAALETFLLPFKELFAEDGINEIMVNKPGEAWVEKKGDIYSKQLPELDAEHLLSLGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMNLTLDEYAKMGAFDETATESLVDQDEIIL
NGYLAEKKIKEFIKHAVISKKNIIISGGTSTGKTTFTNAALTEIPQLERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANITTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|91204815|ref|NC_007940.1|:1115393-1116397 Rickettsia bellii RML369-C chromosome, complete genome
ATGAGTGATGCATTTGCTGCCTTAGAGACCTTTTTATTACCGTTTAAAGAATTATTTGCTGAAGATGGTA
TTAACGAGATTATGGTTAATAAACCTGGAGAGGCATGGGTTGAGAAAAAAGGTGATATATATTCTAAACA
ATTACCAGAGCTTGACGCAGAACATTTACTTTCGCTTGGACGTTTAGTTGCTCAATCTACTGAACAAATG
ATTTCAGAAGAAAAGCCTTTACTTTCAGCCACCCTTCCAAATGGTTATCGTATTCAAATAGTATTTCCAC
CTGCTTGTGAAATAGGACAAATCATTTATTCTATAAGAAAGCCGAGCGGTATGAATCTAACTCTAGATGA
ATATGCTAAAATGGGAGCTTTTGATGAAACTGCAACAGAAAGTTTAGTAGATCAAGATGAAATAATTCTA
AACGGATATTTAGCTGAAAAGAAGATAAAAGAATTCATCAAACATGCAGTTATTTCAAAGAAAAATATTA
TAATTAGCGGCGGTACTTCAACAGGTAAAACTACTTTCACTAATGCAGCACTTACTGAAATACCTCAATT
GGAAAGATTAATTACAGTAGAAGATGCTCGTGAGGTTGTATTATCTAGTCACCCTAATAGAGTTCATTTG
CTTGCTTCTAAAGGCGGGCAAGGACGAGCAAACATTACTACTCAAGATCTAATAGAAGCGTGTTTGCGTT
TAAGACCTGATAGAATTATAGTTGGTGAGCTTCGAGGTAAAGAAGCTTTTAGTTTCTTGCGAGCTATTAA
TACTGGTCACCCAGGTTCTATATCTACACTCCACGCTGATAGTCCTGCTATGGCAATTGAACAACTAAAA
TTGATGGTTATGCAAGCTGATCTTGGTATGCCACCTGAAGAAGTAAAAAAATATATTTTAACAGTTGTAG
ATATTGTAGTACAATTAAAACGTGGCAGTGGCGGTAAAAGATATGTATCGGAAGTATATTATAAAAAGAA
TAAAAACGCCGAAGGAATGGTGTAG
 Primer design