SecReT4
Protein ID: 91205833
T4SS name [ID]VirB [492]
Gene symbolvirD4
Locus tagRBE_1018
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1116530..1118308 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDQ1RHR5
KEGG IDrbe:RBE_1018
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.3e-164, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 1.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 9.1e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.2e-05, Aligned region: 155..481
Protein Sequence: 592 a.a.     [Download]
>gi|91205833|ref|YP_538188.1| type IV secretion system protein VirB8 [Rickettsia bellii RML369-C]
MEWHNILKVTRNIFGHAIIHPVVIFSTLWISGAFVAIFTNEIGTLGVDVTAINIAYKWSYWLVSVWGQLK
ISDYNYLKLKLLASLLGPALVVIIFYIKNFERIKSLQFFEQPEKVYGDARWASPADVESAGLRAKKGMLI
GVDSGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPVKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGIIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNVQEFKKIKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNSTYRITFAANNYETANLISQLVGNKTVEQRS
FSKPIFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYFEDKFFTSRLLPPT
FVPTQVPFDLRANNNETSNETEEAAVAPENSE
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|91204815|ref|NC_007940.1|:1116530-1118308 Rickettsia bellii RML369-C chromosome, complete genome
ATGGAATGGCATAACATACTCAAAGTCACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTAGTACCTTATGGATAAGTGGTGCATTTGTTGCAATCTTTACCAATGAAATTGGGACTCTTGGAGT
AGATGTAACTGCTATAAATATTGCTTACAAATGGTCTTATTGGCTTGTTAGCGTTTGGGGACAATTAAAA
ATCTCTGATTATAACTATTTAAAATTAAAGCTACTTGCTTCACTTCTTGGTCCTGCTCTTGTCGTTATAA
TATTTTACATTAAAAACTTTGAGAGAATCAAATCGCTACAATTTTTTGAGCAACCTGAAAAAGTCTATGG
TGATGCTAGGTGGGCAAGTCCTGCAGATGTTGAATCGGCTGGTCTTAGAGCTAAAAAAGGTATGCTAATC
GGGGTTGATAGTGGTGGTTATTTTGTTGCTGATGGATTCCAGCACGCCTTATTATTTGCTCCTACCGGTT
CTGGTAAAGGTGTGGGTTTTGTTATACCTAACCTATTATTTTGGTCTGATTCCGTAGTCGTTCATGATAT
AAAACTTGAAAACCATGGCTTAACGAGCGGTTGGCGTGAAAAACAAGGTCAGAAAGTCTTTGTATGGGAG
CCATCTAACCCAGATGGTATTACTCACTGCTATAATCCGATTGACTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTACAAAAAATTTCAAACCTTATCATGCCTGAAAAGGATTTCTGGAATAACGAAGCACG
AAGCTTATTCTTGGGCGTAACTTTATATTTAATAGCTGATCCTGTTAAAACCAAATCCTTTGGTGAAGTG
GTGCGTACCATGAGAAGTGACGATGTAGTATATAATCTGGCGGTCGTGCTTGATACTTTAGGCGGAATAA
TCCACCCTGTTGCATATATGAATATTGCAGCTTTCCTACAAAAAGCCGATAAAGAGCGTTCAGGTGTTAT
ATCAACCATGAACTCATCACTTGAGTTATGGGCAAACCCATTAATTGACTCTGCTACTGCTTCTTCCGAT
TTTAATGTACAAGAATTCAAGAAAATAAAAACAACTGTATATGTAGGTCTTACTCCTGATAATATACAAC
GTTTGCAGAAATTAATGCAGGTATTTTATCAGCAAGCTACAGAGTTTTTAAGCCGAAAAATGCCTGATTT
AAAAGAAGAACCTTACGGCGTGATGTTCTTACTTGATGAGTTCCCAACACTTGGTAAGATGGATACGTTC
AAAGCAGGTATTGCTTATTTCAGGGGGTATAGAGTTCGTTTATTCTTAATTATTCAAGATACCCAGCAGC
TAAAAGGAACATATGAAGATGCGGGTATGAACTCTTTCTTATCTAACTCAACATATCGTATTACCTTTGC
TGCTAATAACTATGAAACTGCAAATTTAATATCACAATTAGTCGGTAATAAAACTGTAGAACAAAGATCA
TTCAGCAAACCTATATTTTTTGATCTTAATATTTCTACTAGAACACAAAATGTTTCTCAAGTTCAAAGGG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCAAGAGACGAGCAGATTGTTTTAATAGAGTCTTTTCC
TCCGATAAAATCTCGTAAGATTAAATATTTTGAGGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGATCTGCGAGCAAATAATAATGAAACTTCTAATGAGACAGAAGAGG
CTGCTGTTGCTCCAGAAAACAGTGAGTAA
 Primer design