SecReT4
Protein ID: 91205918
T4SS name [ID]VirB [492]
Gene symbolvirB2
Locus tagRBE_1103
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1193014..1193382 [-]
ProductVirB2-like protein
Component typeVirB2
UniProt IDQ1RHI0
KEGG IDrbe:RBE_1103
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-18, Aligned region: 15..106
Protein Sequence: 122 a.a.     [Download]
>gi|91205918|ref|YP_538273.1| VirB2-like protein [Rickettsia bellii RML369-C]
MNLRKLNEELIDYNMSLRLLFMVLGLAIITMSMDSLAAASVGDPVGAALCNVILVFRGNTARGIAVVGII
VLGIQTLRGKLQWEVALVIVAAIIILFKAPDIVSMVSDSTGNANCGTTSVTS
 
Nucleotide Sequence: 369 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1193382-1193014 Rickettsia bellii RML369-C chromosome, complete genome
ATGAATTTGCGTAAATTAAATGAAGAATTAATTGATTACAACATGTCGCTACGTCTATTATTTATGGTAC
TTGGTTTAGCTATTATAACAATGTCCATGGATAGTTTAGCTGCAGCTAGCGTTGGTGATCCAGTAGGTGC
GGCATTATGTAATGTAATTTTAGTATTTAGAGGTAATACAGCAAGAGGTATTGCCGTTGTTGGTATAATC
GTGCTAGGTATTCAAACACTTAGAGGAAAACTACAATGGGAAGTAGCTTTAGTTATAGTTGCGGCAATTA
TAATATTATTTAAAGCTCCAGACATAGTATCTATGGTATCAGATAGTACTGGTAATGCTAATTGTGGTAC
CACCAGCGTTACTTCGTAA
 Primer design