SecReT4
Protein ID: 91206076
T4SS name [ID]VirB [492]
Gene symbolvirB6-5
Locus tagRBE_1261
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1351723..1355196 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH22
KEGG IDrbe:RBE_1261
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-23, Aligned region: 298..483
Protein Sequence: 1157 a.a.     [Download]
>gi|91206076|ref|YP_538431.1| VirB6 [Rickettsia bellii RML369-C]
MNRNIFITLLISLLALSGCSGDTCIDPDDFGFIKFNISSRYDPSEVTSRQEGDQVAPWRDSAYKVNGYPL
TIMVRPWDYMSGDKNTSGMLSAWCPWYGQQNNFTTLAEFCVRLRPCQFTDGKMCPTPTPRDAPINNAPCI
LTNGVGLYFLIADKGSNPNMSPDSQRSPKGITQHLGEPVASQDYEFYSISSTGKFLQAGGINYQYGCTSL
PCDQASNYAQSSLYFKILDKFYDDNSGQYRVVIKSGVSDTRPDPLQFLTNLIKNELFGTSDKDPGIVRQT
YQQIIETPGYRLSVSALLTLYIMFTGFSFLIGNINMTHVELVVRILKVSVVSILLSTSKAWTFFHDYLFV
FFVEGLAQILQIVQDASTGQSLLSLLISPQTLSKLFSLLFVDPLGFIYIILYLIALYFIFLLIFKATIIY
LTALITIGMIITMAPIFICFMLFNITRSLFENWLRQLISYAIQPIILFVGIAFIGMIIKTEIQSTLGFAV
CKKDFPDLGPINQIFGSFTEDLDSSIGNSIFYWWFPVPMKGGIENFTQADILVPEDYTKKDGTKCLAYQC
IDKRYIQLPFLDLVKDANRISNFINGKFVQLDGLLLIFVSIYLLSKFNDTAISTASFIAGTSGNLTSIQA
VNQQSYDSIMKQVNRPINYATGVISKPINRMQEQTSMFFAEKYQGLMMSRLENKALSSSANKAVQNEVKR
KYGIDHKDVNMQAGADYKNGISKLLDNKTFLPKGGDLDVKKLATMNFGQLRDEFAKNKYGAKNYSSLTSD
QKLELDKFMKSDLGEKGKSAKSLRELASDANFTRDYQSAYKYAHKEMSGRGVGLFGKNIGVLRSWQEMEN
RMKTKRELKEQKRVAIGEKIYAGYTGLKRDALTAIVGKDLRDKYEGNLTSAEWHDFDYNDPQLRTYSESL
KDKERAREVKELQMQINKETLAVQEDILSPEYLARLKRPSDVEYYQELGQRRLIHEVRDRLSEGSDPVIM
GDRFMQEKATDDQMRTMIDNAHQKHAEFIDQDRYTRRQEHYDIMHEKAQENIDRTYKEIKDHFKRDDIKL
EEMPALIAQYEREKPIESFDSKTELSLDKRIEEAVSNFNINAKNYEYSASVLNNIEERKQAITDEVNTQI
DRINKYRENAKMPQYQKPVENSGRKLRKLEDHLRNMK
 
Nucleotide Sequence: 3474 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1355196-1351723 Rickettsia bellii RML369-C chromosome, complete genome
ATGAACAGAAATATTTTTATTACATTATTAATATCGTTATTGGCACTGTCGGGGTGCAGCGGGGATACTT
GTATCGATCCGGATGATTTCGGTTTTATAAAATTTAATATTTCTTCTAGATATGATCCATCTGAAGTTAC
TTCAAGACAAGAGGGGGATCAGGTAGCACCATGGCGGGATAGTGCTTATAAAGTAAATGGTTATCCTTTA
ACAATTATGGTAAGACCTTGGGATTATATGTCTGGGGACAAGAATACTTCAGGGATGTTATCAGCATGGT
GTCCATGGTATGGGCAGCAGAATAATTTTACTACCTTAGCTGAGTTTTGTGTTAGACTGCGACCATGTCA
ATTTACTGACGGTAAGATGTGTCCAACTCCTACGCCAAGAGATGCACCTATTAATAATGCTCCTTGTATA
CTTACAAACGGAGTAGGGCTTTATTTTTTAATTGCTGATAAAGGTTCTAATCCTAATATGTCGCCAGATT
CACAGCGTAGTCCGAAAGGTATAACGCAGCATTTAGGTGAACCAGTTGCAAGCCAAGATTATGAATTTTA
TAGTATTAGTAGTACTGGAAAGTTTTTACAAGCCGGTGGTATAAATTACCAATATGGTTGTACTAGCCTA
CCTTGCGATCAAGCTTCAAATTATGCTCAATCTTCTCTATATTTTAAAATTTTAGACAAATTTTATGATG
ATAATAGTGGACAATATAGGGTAGTAATAAAATCCGGAGTCAGCGATACAAGACCTGATCCCCTACAATT
TTTAACAAATTTAATAAAGAATGAGTTATTTGGTACTAGCGATAAAGATCCTGGAATTGTAAGGCAAACT
TATCAGCAAATAATTGAAACACCTGGCTATAGGTTAAGTGTTTCGGCTCTTTTAACTCTTTATATAATGT
TTACTGGATTTTCCTTTTTAATAGGAAACATAAACATGACTCATGTTGAGTTAGTAGTTAGAATACTAAA
AGTCAGTGTAGTTTCAATATTATTAAGTACAAGTAAAGCTTGGACATTTTTCCATGATTATTTATTTGTA
TTTTTTGTTGAAGGGCTAGCACAGATATTACAAATAGTACAAGATGCTTCAACAGGGCAAAGTTTACTAA
GCCTTCTTATTTCCCCGCAAACTTTATCTAAGCTATTTTCTTTATTGTTTGTAGATCCGCTTGGGTTTAT
TTATATCATACTATATTTAATAGCTCTGTATTTTATTTTCTTACTTATATTCAAAGCTACAATTATTTAT
CTTACTGCATTAATAACCATTGGTATGATTATAACAATGGCACCGATATTTATTTGTTTCATGTTATTTA
ATATAACTAGATCGTTATTTGAAAATTGGTTAAGGCAATTAATATCATATGCTATACAACCTATAATTTT
ATTTGTCGGTATTGCTTTTATCGGAATGATTATTAAAACAGAAATACAATCGACATTAGGTTTTGCCGTC
TGTAAGAAAGATTTCCCCGATTTAGGACCTATAAATCAAATTTTTGGTAGTTTTACAGAAGATTTAGATT
CAAGTATTGGTAATTCGATATTTTATTGGTGGTTTCCGGTACCGATGAAAGGAGGAATTGAGAATTTCAC
TCAAGCAGATATATTAGTCCCCGAAGATTATACCAAAAAGGATGGTACTAAGTGTTTGGCATATCAATGT
ATAGATAAACGTTATATTCAATTACCGTTTTTAGACTTAGTTAAAGATGCAAATAGAATTAGTAATTTTA
TAAATGGTAAATTCGTCCAGCTTGATGGCTTATTATTGATATTTGTTTCTATTTATTTGCTTAGTAAATT
TAATGATACTGCTATATCGACGGCTAGTTTTATTGCGGGTACTTCGGGTAATTTAACATCGATACAGGCT
GTTAACCAGCAATCTTACGATTCTATCATGAAGCAGGTCAATAGACCGATAAATTATGCAACAGGAGTTA
TTAGTAAGCCGATAAACCGAATGCAAGAGCAAACGAGTATGTTTTTTGCTGAAAAATATCAAGGGCTTAT
GATGAGTAGGCTTGAAAATAAAGCCCTCAGTTCTTCGGCTAACAAAGCAGTGCAAAATGAAGTTAAAAGA
AAATATGGTATAGACCATAAAGACGTTAATATGCAAGCCGGAGCAGATTATAAAAACGGCATTTCTAAAT
TGCTAGATAATAAAACGTTTTTACCGAAAGGTGGTGATTTAGATGTGAAAAAACTAGCAACTATGAATTT
TGGGCAGCTTCGAGATGAATTTGCCAAAAATAAATATGGTGCAAAAAATTATAGCTCTTTAACTAGTGAT
CAGAAACTAGAGCTTGATAAATTCATGAAATCCGATTTAGGTGAGAAAGGTAAATCAGCAAAAAGCTTAC
GTGAGCTTGCAAGTGATGCAAACTTTACTAGAGATTATCAAAGTGCTTATAAATATGCTCATAAAGAAAT
GTCAGGAAGAGGAGTTGGTCTATTTGGTAAAAATATAGGAGTGCTTAGAAGCTGGCAAGAAATGGAAAAT
CGCATGAAAACTAAACGTGAATTAAAAGAACAAAAACGTGTAGCTATAGGTGAGAAAATATATGCCGGCT
ATACAGGATTAAAAAGAGATGCTCTTACTGCGATAGTTGGTAAAGATTTACGTGATAAATATGAGGGTAA
TCTAACTAGTGCCGAGTGGCATGACTTTGACTATAACGATCCACAGCTTAGAACTTATAGCGAAAGTCTA
AAAGATAAAGAAAGAGCACGAGAAGTCAAAGAGCTTCAAATGCAGATTAATAAAGAAACGCTTGCTGTTC
AAGAAGATATATTATCGCCTGAATATTTAGCAAGATTAAAAAGACCAAGTGATGTAGAATATTATCAGGA
ATTAGGTCAAAGAAGGCTTATTCATGAAGTGCGTGATAGATTATCTGAAGGAAGTGATCCAGTGATAATG
GGTGATAGATTTATGCAAGAAAAAGCTACCGATGATCAAATGCGGACTATGATAGATAATGCTCATCAAA
AACATGCAGAATTTATAGATCAAGATAGATATACTCGTCGTCAAGAGCATTACGATATTATGCATGAAAA
AGCTCAAGAAAATATCGACAGAACTTATAAAGAGATTAAAGATCATTTCAAAAGAGATGATATTAAGCTT
GAGGAAATGCCAGCTTTAATAGCACAATATGAAAGAGAGAAACCAATAGAATCTTTTGATAGTAAGACAG
AGCTTTCTCTAGATAAAAGGATTGAAGAAGCAGTTAGTAACTTTAATATCAATGCTAAAAATTATGAATA
TAGTGCATCGGTGCTTAATAATATAGAAGAAAGAAAGCAGGCTATTACTGATGAAGTAAATACTCAAATT
GATCGAATTAATAAATATAGAGAAAATGCTAAAATGCCGCAATACCAGAAACCGGTAGAAAATTCAGGAA
GAAAGCTCAGAAAATTAGAAGACCATTTGAGAAATATGAAGTAA
 Primer design